BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30194 (516 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X54504-1|CAA38366.1| 396|Drosophila melanogaster drosophila tro... 67 1e-11 AY439172-5|AAR24586.1| 374|Drosophila melanogaster troponin T-4... 67 1e-11 AY439172-3|AAR24585.1| 388|Drosophila melanogaster troponin T-3... 67 1e-11 AY439172-2|AAR24584.1| 396|Drosophila melanogaster troponin T-2... 67 1e-11 AY439172-1|AAR24583.1| 397|Drosophila melanogaster troponin T-1... 67 1e-11 AY051989-1|AAK93413.1| 306|Drosophila melanogaster LD45641p pro... 67 1e-11 AE014298-1927|AAF48288.2| 306|Drosophila melanogaster CG7107-PD... 67 1e-11 AE014298-1926|AAX52493.1| 393|Drosophila melanogaster CG7107-PF... 67 1e-11 AE014298-1925|AAF48290.1| 397|Drosophila melanogaster CG7107-PA... 67 1e-11 AE014298-1924|AAX52492.1| 396|Drosophila melanogaster CG7107-PG... 67 1e-11 AE014298-1923|AAF48289.2| 389|Drosophila melanogaster CG7107-PB... 67 1e-11 AE014298-1922|AAX52491.1| 374|Drosophila melanogaster CG7107-PE... 67 1e-11 AY665838-1|AAU09446.1| 374|Drosophila melanogaster troponin T p... 65 6e-11 AY439172-4|AAR24587.1| 374|Drosophila melanogaster troponin T-5... 65 6e-11 BT011556-1|AAS15692.1| 293|Drosophila melanogaster AT30717p pro... 29 3.7 AE014298-807|AAF46093.1| 293|Drosophila melanogaster CG15764-PA... 29 3.7 AY122240-1|AAM52752.1| 124|Drosophila melanogaster SD02058p pro... 28 6.5 AE014296-3146|AAO41235.1| 124|Drosophila melanogaster CG33062-P... 28 6.5 >X54504-1|CAA38366.1| 396|Drosophila melanogaster drosophila troponin-T protein. Length = 396 Score = 67.3 bits (157), Expect = 1e-11 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 439 EKVWQERAEQFGGRQKARLPKWFGERPGKKKGELESP 329 EK+W E+ EQ+ GRQK++LPKWFGERPGKK GE E+P Sbjct: 296 EKIWNEKKEQYTGRQKSKLPKWFGERPGKKAGEPETP 332 >AY439172-5|AAR24586.1| 374|Drosophila melanogaster troponin T-4 protein. Length = 374 Score = 67.3 bits (157), Expect = 1e-11 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 439 EKVWQERAEQFGGRQKARLPKWFGERPGKKKGELESP 329 EK+W E+ EQ+ GRQK++LPKWFGERPGKK GE E+P Sbjct: 274 EKIWNEKKEQYTGRQKSKLPKWFGERPGKKAGEPETP 310 >AY439172-3|AAR24585.1| 388|Drosophila melanogaster troponin T-3 protein. Length = 388 Score = 67.3 bits (157), Expect = 1e-11 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 439 EKVWQERAEQFGGRQKARLPKWFGERPGKKKGELESP 329 EK+W E+ EQ+ GRQK++LPKWFGERPGKK GE E+P Sbjct: 288 EKIWNEKKEQYTGRQKSKLPKWFGERPGKKAGEPETP 324 >AY439172-2|AAR24584.1| 396|Drosophila melanogaster troponin T-2 protein. Length = 396 Score = 67.3 bits (157), Expect = 1e-11 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 439 EKVWQERAEQFGGRQKARLPKWFGERPGKKKGELESP 329 EK+W E+ EQ+ GRQK++LPKWFGERPGKK GE E+P Sbjct: 296 EKIWNEKKEQYTGRQKSKLPKWFGERPGKKAGEPETP 332 >AY439172-1|AAR24583.1| 397|Drosophila melanogaster troponin T-1 protein. Length = 397 Score = 67.3 bits (157), Expect = 1e-11 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 439 EKVWQERAEQFGGRQKARLPKWFGERPGKKKGELESP 329 EK+W E+ EQ+ GRQK++LPKWFGERPGKK GE E+P Sbjct: 297 EKIWNEKKEQYTGRQKSKLPKWFGERPGKKAGEPETP 333 >AY051989-1|AAK93413.1| 306|Drosophila melanogaster LD45641p protein. Length = 306 Score = 67.3 bits (157), Expect = 1e-11 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 439 EKVWQERAEQFGGRQKARLPKWFGERPGKKKGELESP 329 EK+W E+ EQ+ GRQK++LPKWFGERPGKK GE E+P Sbjct: 206 EKIWNEKKEQYTGRQKSKLPKWFGERPGKKAGEPETP 242 >AE014298-1927|AAF48288.2| 306|Drosophila melanogaster CG7107-PD, isoform D protein. Length = 306 Score = 67.3 bits (157), Expect = 1e-11 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 439 EKVWQERAEQFGGRQKARLPKWFGERPGKKKGELESP 329 EK+W E+ EQ+ GRQK++LPKWFGERPGKK GE E+P Sbjct: 206 EKIWNEKKEQYTGRQKSKLPKWFGERPGKKAGEPETP 242 >AE014298-1926|AAX52493.1| 393|Drosophila melanogaster CG7107-PF, isoform F protein. Length = 393 Score = 67.3 bits (157), Expect = 1e-11 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 439 EKVWQERAEQFGGRQKARLPKWFGERPGKKKGELESP 329 EK+W E+ EQ+ GRQK++LPKWFGERPGKK GE E+P Sbjct: 293 EKIWNEKKEQYTGRQKSKLPKWFGERPGKKAGEPETP 329 >AE014298-1925|AAF48290.1| 397|Drosophila melanogaster CG7107-PA, isoform A protein. Length = 397 Score = 67.3 bits (157), Expect = 1e-11 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 439 EKVWQERAEQFGGRQKARLPKWFGERPGKKKGELESP 329 EK+W E+ EQ+ GRQK++LPKWFGERPGKK GE E+P Sbjct: 297 EKIWNEKKEQYTGRQKSKLPKWFGERPGKKAGEPETP 333 >AE014298-1924|AAX52492.1| 396|Drosophila melanogaster CG7107-PG, isoform G protein. Length = 396 Score = 67.3 bits (157), Expect = 1e-11 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 439 EKVWQERAEQFGGRQKARLPKWFGERPGKKKGELESP 329 EK+W E+ EQ+ GRQK++LPKWFGERPGKK GE E+P Sbjct: 296 EKIWNEKKEQYTGRQKSKLPKWFGERPGKKAGEPETP 332 >AE014298-1923|AAF48289.2| 389|Drosophila melanogaster CG7107-PB, isoform B protein. Length = 389 Score = 67.3 bits (157), Expect = 1e-11 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 439 EKVWQERAEQFGGRQKARLPKWFGERPGKKKGELESP 329 EK+W E+ EQ+ GRQK++LPKWFGERPGKK GE E+P Sbjct: 289 EKIWNEKKEQYTGRQKSKLPKWFGERPGKKAGEPETP 325 >AE014298-1922|AAX52491.1| 374|Drosophila melanogaster CG7107-PE, isoform E protein. Length = 374 Score = 67.3 bits (157), Expect = 1e-11 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 439 EKVWQERAEQFGGRQKARLPKWFGERPGKKKGELESP 329 EK+W E+ EQ+ GRQK++LPKWFGERPGKK GE E+P Sbjct: 274 EKIWNEKKEQYTGRQKSKLPKWFGERPGKKAGEPETP 310 >AY665838-1|AAU09446.1| 374|Drosophila melanogaster troponin T protein. Length = 374 Score = 64.9 bits (151), Expect = 6e-11 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -3 Query: 442 LEKVWQERAEQFGGRQKARLPKWFGERPGKKKGELESP 329 LEK WQER E+F R K++LPKWFGERPGKK GE E+P Sbjct: 273 LEKTWQERQERFTQRTKSKLPKWFGERPGKKAGEPETP 310 >AY439172-4|AAR24587.1| 374|Drosophila melanogaster troponin T-5 protein. Length = 374 Score = 64.9 bits (151), Expect = 6e-11 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -3 Query: 442 LEKVWQERAEQFGGRQKARLPKWFGERPGKKKGELESP 329 LEK WQER E+F R K++LPKWFGERPGKK GE E+P Sbjct: 273 LEKTWQERQERFTQRTKSKLPKWFGERPGKKAGEPETP 310 >BT011556-1|AAS15692.1| 293|Drosophila melanogaster AT30717p protein. Length = 293 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 498 RPVNCNTTHYRANWVPGPPSRRCGKRGPNSSA 403 R V C T P PPS RC K G SSA Sbjct: 107 RVVQCKTARIPVTPPPPPPSPRCPKPGELSSA 138 >AE014298-807|AAF46093.1| 293|Drosophila melanogaster CG15764-PA protein. Length = 293 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 498 RPVNCNTTHYRANWVPGPPSRRCGKRGPNSSA 403 R V C T P PPS RC K G SSA Sbjct: 107 RVVQCKTARIPVTPPPPPPSPRCPKPGELSSA 138 >AY122240-1|AAM52752.1| 124|Drosophila melanogaster SD02058p protein. Length = 124 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -1 Query: 513 DVVKRRPVNCNTTHYRANWVPGPPSRRCGKR 421 D +K RP NC T H A WV R C R Sbjct: 2 DQLKLRPCNCLTAHPLAEWVWVECERLCTLR 32 >AE014296-3146|AAO41235.1| 124|Drosophila melanogaster CG33062-PA protein. Length = 124 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -1 Query: 513 DVVKRRPVNCNTTHYRANWVPGPPSRRCGKR 421 D +K RP NC T H A WV R C R Sbjct: 2 DQLKLRPCNCLTAHPLAEWVWVECERLCTLR 32 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,555,976 Number of Sequences: 53049 Number of extensions: 207125 Number of successful extensions: 636 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 636 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1887744768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -