BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30190 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 27 0.38 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 27 0.38 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 27 0.38 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 27 0.38 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 27 0.38 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 27 0.38 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 27 0.38 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 27 0.38 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 27 0.38 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 27 0.38 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 27 0.38 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 27 0.38 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 27 0.38 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 27 0.38 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 25 2.0 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 24 3.5 AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 24 3.5 AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 24 3.5 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 4.6 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 23 6.1 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 23 6.1 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 23 6.1 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.38 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 40 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 177 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.38 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 40 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 177 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.38 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 40 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 177 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.38 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 40 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 177 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.38 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 40 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 177 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.38 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 40 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 177 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.38 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 40 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 177 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.38 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 40 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 177 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.38 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 40 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 177 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.38 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 40 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 177 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.38 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 40 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 177 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.38 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 40 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 177 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.38 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 40 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 177 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 398 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 439 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 27.1 bits (57), Expect = 0.38 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 40 PNFFPNGYQDPKH-PEEEVVSNWPYRTTPLVLPGAKVRREPGPTESY 177 PN+FPN + P+ P + N TPL L G R E G +++ Sbjct: 382 PNYFPNSFSGPQTCPRAHKLQN-----TPLKLSGDVNRYETGDEDNF 423 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 24.6 bits (51), Expect = 2.0 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +1 Query: 259 HKQFNSPINLYSEQNIANSIRQQTSPLPPRP 351 H Q N +LYS +N + R + P P P Sbjct: 1101 HNQDNDRTSLYSARNTSEEQRGRRHPTPSPP 1131 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 23.8 bits (49), Expect = 3.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 Query: 433 SAPVATKVFTAPTSKRPAPTPK 498 +APVATKV P AP K Sbjct: 92 AAPVATKVIAQPAVAYAAPVAK 113 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 23.8 bits (49), Expect = 3.5 Identities = 11/37 (29%), Positives = 15/37 (40%) Frame = +1 Query: 406 GLPDAATELSAPVATKVFTAPTSKRPAPTPKPTKQSD 516 G + T +A T T T+ TP P +SD Sbjct: 141 GATTSTTSTTATTTTTTTTTTTTTTTTTTPNPVGESD 177 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 23.8 bits (49), Expect = 3.5 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 401 SCSARYVSDLAGSYCAAGLGGRGEV 327 SCS+RY + SY G+ G + Sbjct: 28 SCSSRYTDSVMNSYPPMGVPGSASI 52 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.4 bits (48), Expect = 4.6 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 457 FTAPTSKRPAPTPKP 501 FT PT + P P P P Sbjct: 795 FTPPTDRTPTPPPLP 809 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 23.0 bits (47), Expect = 6.1 Identities = 24/87 (27%), Positives = 36/87 (41%), Gaps = 3/87 (3%) Frame = +1 Query: 259 HKQFNSPINLYSEQNIANSIRQQTSPLPPR-PAAQYDPAKSETYRALQEDGLPDAATELS 435 H FN P ++ SE+ QQT P + + +A DG+P+AA + + Sbjct: 453 HPPFNWP-SISSEEEQEQPADQQTPWTQVTIPELRLIASTMPNKKAPGLDGIPNAAVKAA 511 Query: 436 APVATKVFTA--PTSKRPAPTPKPTKQ 510 T VF A + A P P K+ Sbjct: 512 ILAYTDVFQALYQSCLETATFPAPWKR 538 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 23.0 bits (47), Expect = 6.1 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 132 PGS*GPKGAWPHRELPASSPQPSNEGT 212 PG G KGA R P S P +GT Sbjct: 108 PGPMGLKGAKGVRGFPGSEGLPGEKGT 134 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 23.0 bits (47), Expect = 6.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 90 FFFRMFRILVSVREEVGVER 31 FF MFR V REE G+ R Sbjct: 252 FFTEMFRQSVQEREEHGIVR 271 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.310 0.128 0.385 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 500,818 Number of Sequences: 2352 Number of extensions: 10912 Number of successful extensions: 40 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -