BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30182 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier prot... 204 1e-54 L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier prot... 204 1e-54 AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocas... 204 1e-54 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 23 1.1 AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome convers... 23 6.1 DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. 23 8.1 >L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 204 bits (498), Expect = 1e-54 Identities = 97/114 (85%), Positives = 102/114 (89%) Frame = +2 Query: 173 MSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAF 352 M+ ADP FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ SKQIA D++YKGIVD F Sbjct: 1 MTKKADPYGFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCF 60 Query: 353 VRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRY 514 VRIPKEQG+ +FWRGN ANVIRYFPTQALNFAFKD YKQVFLGGVDK TQFWRY Sbjct: 61 VRIPKEQGIGAFWRGNLANVIRYFPTQALNFAFKDVYKQVFLGGVDKNTQFWRY 114 Score = 35.5 bits (78), Expect = 0.001 Identities = 22/69 (31%), Positives = 39/69 (56%) Frame = +2 Query: 260 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 439 P + V+ + +Q S ++ YK +D +V+I K++G +F++G F+NV+R AL Sbjct: 232 PFDTVRRRMMMQ--SWPCKSEVMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLR-GTGGAL 288 Query: 440 NFAFKDKYK 466 F D+ K Sbjct: 289 VLVFYDEVK 297 >L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 204 bits (498), Expect = 1e-54 Identities = 97/114 (85%), Positives = 102/114 (89%) Frame = +2 Query: 173 MSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAF 352 M+ ADP FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ SKQIA D++YKGIVD F Sbjct: 1 MTKKADPYGFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCF 60 Query: 353 VRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRY 514 VRIPKEQG+ +FWRGN ANVIRYFPTQALNFAFKD YKQVFLGGVDK TQFWRY Sbjct: 61 VRIPKEQGIGAFWRGNLANVIRYFPTQALNFAFKDVYKQVFLGGVDKNTQFWRY 114 Score = 35.5 bits (78), Expect = 0.001 Identities = 22/69 (31%), Positives = 39/69 (56%) Frame = +2 Query: 260 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 439 P + V+ + +Q S ++ YK +D +V+I K++G +F++G F+NV+R AL Sbjct: 232 PFDTVRRRMMMQ--SWPCKSEVMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLR-GTGGAL 288 Query: 440 NFAFKDKYK 466 F D+ K Sbjct: 289 VLVFYDEVK 297 >AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocase protein. Length = 301 Score = 204 bits (498), Expect = 1e-54 Identities = 97/114 (85%), Positives = 102/114 (89%) Frame = +2 Query: 173 MSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAF 352 M+ ADP FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ SKQIA D++YKGIVD F Sbjct: 1 MTKKADPYGFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCF 60 Query: 353 VRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRY 514 VRIPKEQG+ +FWRGN ANVIRYFPTQALNFAFKD YKQVFLGGVDK TQFWRY Sbjct: 61 VRIPKEQGIGAFWRGNLANVIRYFPTQALNFAFKDVYKQVFLGGVDKNTQFWRY 114 Score = 36.7 bits (81), Expect = 5e-04 Identities = 22/69 (31%), Positives = 40/69 (57%) Frame = +2 Query: 260 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 439 P + V+ + +Q S + ++ YK +D +V+I K++G +F++G F+NV+R AL Sbjct: 232 PFDTVRRRMMMQ--SGRAKSEVMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLR-GTGGAL 288 Query: 440 NFAFKDKYK 466 F D+ K Sbjct: 289 VLVFYDEVK 297 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 22.6 bits (46), Expect(2) = 1.1 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 347 RRRYPCNAGRR 315 RRRYP NAG + Sbjct: 346 RRRYPTNAGHK 356 Score = 21.0 bits (42), Expect(2) = 1.1 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = -2 Query: 404 RSYHARMKGDPAPWGCGRRRRRYP 333 R R++ P P R RRR P Sbjct: 315 REAAGRLRTGPVPGAAERHRRRRP 338 >AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome conversion enzyme protein. Length = 462 Score = 23.0 bits (47), Expect = 6.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 Query: 431 QALNFAFKDKYKQVFLGGVDKKTQF 505 Q +NFA+ D + LG D T+F Sbjct: 237 QGINFAWDDGIFSIALGNPDPVTKF 261 >DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. Length = 553 Score = 22.6 bits (46), Expect = 8.1 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 121 ATPTSTYSPSEDHIIEQNVEP 183 A PT+ P EDH + ++P Sbjct: 434 ADPTAVIFPHEDHYSQPQLQP 454 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 520,025 Number of Sequences: 2352 Number of extensions: 10488 Number of successful extensions: 19 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -