BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30172 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54925| Best HMM Match : MFS_1 (HMM E-Value=4.7e-27) 55 4e-08 SB_39782| Best HMM Match : Chromo_shadow (HMM E-Value=1.4e-23) 53 1e-07 SB_26989| Best HMM Match : Chromo (HMM E-Value=5.5e-10) 48 5e-06 SB_32465| Best HMM Match : Chromo (HMM E-Value=3.5e-16) 48 6e-06 SB_56934| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_57673| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.011 SB_28997| Best HMM Match : rve (HMM E-Value=2.3e-10) 37 0.011 SB_23869| Best HMM Match : rve (HMM E-Value=2.2e-16) 36 0.026 SB_21158| Best HMM Match : Chromo (HMM E-Value=0.00035) 32 0.24 SB_16955| Best HMM Match : SLAP (HMM E-Value=0.048) 32 0.32 SB_58421| Best HMM Match : Pro-MCH (HMM E-Value=7.7) 31 0.74 SB_44610| Best HMM Match : PI3Ka (HMM E-Value=6.1e-32) 31 0.74 SB_13820| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.98 SB_58697| Best HMM Match : Chromo (HMM E-Value=5.5e-09) 29 1.7 SB_20812| Best HMM Match : rve (HMM E-Value=1.2e-25) 29 1.7 SB_7412| Best HMM Match : IRK (HMM E-Value=2.2e-20) 29 1.7 SB_8638| Best HMM Match : PP2C (HMM E-Value=6.5e-32) 29 2.3 SB_48843| Best HMM Match : V_ATPase_I (HMM E-Value=0) 29 2.3 SB_30175| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_51384| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_9085| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_24318| Best HMM Match : Pox_A32 (HMM E-Value=0.029) 28 5.3 SB_19215| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_59237| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_20844| Best HMM Match : Ion_trans (HMM E-Value=0) 28 5.3 SB_18195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_15785| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_54236| Best HMM Match : bZIP_1 (HMM E-Value=1.1) 27 6.9 SB_45072| Best HMM Match : Kazal_2 (HMM E-Value=5.8e-06) 27 6.9 SB_40018| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_50139| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_47174| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_28941| Best HMM Match : PI3_PI4_kinase (HMM E-Value=2.8026e-45) 27 9.2 SB_50077| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_48195| Best HMM Match : DUF229 (HMM E-Value=0) 27 9.2 SB_26166| Best HMM Match : Mito_carr (HMM E-Value=0) 27 9.2 SB_10723| Best HMM Match : Chromo (HMM E-Value=0.031) 27 9.2 >SB_54925| Best HMM Match : MFS_1 (HMM E-Value=4.7e-27) Length = 1373 Score = 54.8 bits (126), Expect = 4e-08 Identities = 22/48 (45%), Positives = 33/48 (68%) Frame = +1 Query: 49 VEKILGFKYENGKEYFHVKWKGWSDSENTWEPIENLDNCPAIIKNFLD 192 VEKIL + + GK + V+WKG+ +++TWEP +NL C +I NFL+ Sbjct: 907 VEKILDRRVQRGKVEYLVRWKGYGPADDTWEPSKNLKGCKELIDNFLN 954 >SB_39782| Best HMM Match : Chromo_shadow (HMM E-Value=1.4e-23) Length = 226 Score = 53.2 bits (122), Expect = 1e-07 Identities = 24/50 (48%), Positives = 33/50 (66%) Frame = +1 Query: 37 EEYIVEKILGFKYENGKEYFHVKWKGWSDSENTWEPIENLDNCPAIIKNF 186 EEY VEK++ + NG + +KWKG+ DSENTWE E L CP +I+ + Sbjct: 26 EEYEVEKVMDKRVINGGIEYLLKWKGYPDSENTWESEEGL-QCPELIEEY 74 Score = 27.5 bits (58), Expect = 6.9 Identities = 16/57 (28%), Positives = 28/57 (49%) Frame = +1 Query: 34 AEEYIVEKILGFKYENGKEYFHVKWKGWSDSENTWEPIENLDNCPAIIKNFLDEEET 204 AE + + ILG +G+ +F ++WK ++ + NL P I+ F +E T Sbjct: 126 AEGWEADTILGATEVDGQIHFLIQWKSTDRADLIPSKVANL-KWPQIVIKFYEERVT 181 >SB_26989| Best HMM Match : Chromo (HMM E-Value=5.5e-10) Length = 517 Score = 48.0 bits (109), Expect = 5e-06 Identities = 25/88 (28%), Positives = 46/88 (52%) Frame = +1 Query: 67 FKYENGKEYFHVKWKGWSDSENTWEPIENLDNCPAIIKNFLDEEETRFCVKIQKLKEEIS 246 F ++G YF V+WKG++ ++TWEP EN+ C +++ F + Q+++++I Sbjct: 10 FVAQDGVRYFKVRWKGYTPDDDTWEPEENVFECEDVLEEFWKRRRRNRERRRQQIQKDIF 69 Query: 247 FGNLLEDNNLIERFTEFEDADLSKIKEN 330 G IE + ED + +KE+ Sbjct: 70 EG-------CIEGKVKDEDGESDPLKES 90 >SB_32465| Best HMM Match : Chromo (HMM E-Value=3.5e-16) Length = 411 Score = 47.6 bits (108), Expect = 6e-06 Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 1/73 (1%) Frame = +1 Query: 43 YIVEKILGFKYENGKEYFHVKWKGWSDSENTWEPIENLDNCPAIIKNFLDE-EETRFCVK 219 Y E IL + +GK ++ +KWKG+S NTWEP EN+ + P ++K + + + VK Sbjct: 25 YAAETILKERVRDGKVWYFIKWKGYSQRYNTWEPEENVLD-PRLLKAYQERLALSEKKVK 83 Query: 220 IQKLKEEISFGNL 258 +K+K G + Sbjct: 84 RKKVKPSTEVGGV 96 >SB_56934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2541 Score = 43.2 bits (97), Expect = 1e-04 Identities = 19/48 (39%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Frame = +1 Query: 49 VEKILGFKY-ENGKEYFHVKWKGWSDSENTWEPIENLDNCPAIIKNFL 189 + +I+G + ++GKE + V WK + E+TWEP+ENL C A + F+ Sbjct: 24 INEIIGRRITQSGKEEYLVHWKKYKVWESTWEPLENLRPCLANVAEFI 71 >SB_57673| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 508 Score = 36.7 bits (81), Expect = 0.011 Identities = 33/118 (27%), Positives = 55/118 (46%), Gaps = 5/118 (4%) Frame = +1 Query: 175 IKNFLDEEETRFCVKIQKLKEEISFGNLLEDN--NLIERFTEFEDADLSKIKENLQLKFL 348 +KN +D+ E R LKE + G+ E+N +I R ED +L++I +L Sbjct: 275 VKNAIDDAEDREAEAKYHLKEALERGDKAEENIEGMIRRRKLLED-ELARITASLDQATQ 333 Query: 349 SILFLTEKEEHCGATLVEETRDILQLYVLVRKR---CKQLMQLKEWEDHLNQVDKSKK 513 + K E AT E L++ ++ +R CK+ + + E E H N +D +K Sbjct: 334 QLFEKRNKTEEEQATEKELGHMELEIDEVLNERECQCKEALAIAE-EKHQNYIDACRK 390 >SB_28997| Best HMM Match : rve (HMM E-Value=2.3e-10) Length = 1847 Score = 36.7 bits (81), Expect = 0.011 Identities = 13/62 (20%), Positives = 29/62 (46%) Frame = +1 Query: 37 EEYIVEKILGFKYENGKEYFHVKWKGWSDSENTWEPIENLDNCPAIIKNFLDEEETRFCV 216 + + ++ ++ + G++ + V WKGW D +W P + N +DE+ + V Sbjct: 1074 QHFKIDSVVKTRKRGGRKVYWVHWKGWPDKYKSWVPATEVHKVLGSRGNTMDEDSSSMYV 1133 Query: 217 KI 222 + Sbjct: 1134 TL 1135 >SB_23869| Best HMM Match : rve (HMM E-Value=2.2e-16) Length = 1456 Score = 35.5 bits (78), Expect = 0.026 Identities = 15/63 (23%), Positives = 31/63 (49%) Frame = +1 Query: 34 AEEYIVEKILGFKYENGKEYFHVKWKGWSDSENTWEPIENLDNCPAIIKNFLDEEETRFC 213 A + ++++L G+ + V WKGW D N+W P ++ + + +DE+ + Sbjct: 1224 AHPFKIDRVLKTWKRGGRGEYWVHWKGWPDKYNSWVPATEVNK--VLRGSIMDEDSSSMY 1281 Query: 214 VKI 222 V + Sbjct: 1282 VTL 1284 >SB_21158| Best HMM Match : Chromo (HMM E-Value=0.00035) Length = 132 Score = 32.3 bits (70), Expect = 0.24 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 2/51 (3%) Frame = +1 Query: 43 YIVEKILGFKY--ENGKEYFHVKWKGWSDSENTWEPIENLDNCPAIIKNFL 189 Y VE+I+ + NG + + VKWK W +T EP +L A+I+++L Sbjct: 41 YDVERIISQRITSRNGDKEYLVKWKNWPIWTSTLEPANHLTE--ALIRSYL 89 >SB_16955| Best HMM Match : SLAP (HMM E-Value=0.048) Length = 1952 Score = 31.9 bits (69), Expect = 0.32 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 3/78 (3%) Frame = -2 Query: 413 SLVSSTSVAPQCSSFSVKNSIDKNFNCKFSFILLRS---ASSNSVNLSMRLLSSKRLPNE 243 S ++ST+ S K+SID + S + + ASS +++ M S L + Sbjct: 917 SSITSTATQTDIRSIGTKSSIDVSLPFSSSLAVRSTPVAASSEGIDMGMTESLSAHLTSP 976 Query: 242 ISSLSFCILTQNLVSSSS 189 ISS+SF +L+ S S Sbjct: 977 ISSVSFTVLSTEKYPSHS 994 >SB_58421| Best HMM Match : Pro-MCH (HMM E-Value=7.7) Length = 233 Score = 30.7 bits (66), Expect = 0.74 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = -3 Query: 187 KNFLLLQDSYLGFQ*VPKYFHYQTILSISHESILFHFHT*TLVFSQQYIL 38 K+F + + LGFQ Y + I +++ +F+FHT +F+ Y+L Sbjct: 156 KDFDSTKTTLLGFQKNTNNDSYPNFVRIPYKNGMFYFHTQPAIFTNYYLL 205 >SB_44610| Best HMM Match : PI3Ka (HMM E-Value=6.1e-32) Length = 773 Score = 30.7 bits (66), Expect = 0.74 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = -2 Query: 335 CKFSFILLRSASSNSVNLSM-RLLSSKRLPNEISSLSFCILTQNLVSSSSK 186 C +F+ LR +S S + S+ R LPN+I++ C+LT++ SSS+ Sbjct: 668 CYTAFLHLRRSSFVSSSRSLCRGADIVHLPNQIAACKSCVLTESSFVSSSR 718 >SB_13820| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 646 Score = 30.3 bits (65), Expect = 0.98 Identities = 24/84 (28%), Positives = 38/84 (45%), Gaps = 7/84 (8%) Frame = +1 Query: 154 LDNCPAIIKNFLDEEETRFC-VKIQKLKEEISFGNLLEDNNLIERFTEFE--DADLSKIK 324 L C K FL+E E ++C V + L EE D L+ +E + D D + Sbjct: 221 LQYCDVDTKLFLEESELQYCDVDTKLLLEESELQYCDVDTKLLSEESELQYCDVDTKLLS 280 Query: 325 ENLQLKFLSI---LFLTEKE-EHC 384 E +L++ + LF E E ++C Sbjct: 281 EESELQYCDVDTKLFSEESELQYC 304 Score = 28.3 bits (60), Expect = 4.0 Identities = 25/91 (27%), Positives = 40/91 (43%), Gaps = 5/91 (5%) Frame = +1 Query: 121 DSENTWEPIENLDNCPAIIKNFLDEEETRFCVKIQKL-KEEISFGNLLEDNNLIERFTEF 297 D++ W E L C A K F +E E ++C KL EE D L+ +E Sbjct: 355 DTKLPWGKSE-LQYCDADTKLFSEESELQYCDADTKLFSEESELQYWDVDTKLLSEASEL 413 Query: 298 E--DADLSKIKENLQLKFLSI--LFLTEKEE 378 + D D + E +L++ + L+E+ E Sbjct: 414 QYCDVDTKLLSEASELQYCDVDTKLLSEESE 444 >SB_58697| Best HMM Match : Chromo (HMM E-Value=5.5e-09) Length = 590 Score = 29.5 bits (63), Expect = 1.7 Identities = 23/91 (25%), Positives = 39/91 (42%), Gaps = 5/91 (5%) Frame = +1 Query: 43 YIVEKILGFKYENGKEYFHVKWKGWSDSENTWEPIENLDNCPAIIKNFLDEEETRFCVKI 222 +IV+K+L + + + V W SD TWEP N+ + K + R C+ + Sbjct: 401 FIVKKLLNCRRRSKTTEYLVLW---SDDSQTWEPRHNI-----LDKRLITHYNHRTCLVV 452 Query: 223 QKLKEEISFGNLLEDN-----NLIERFTEFE 300 K FG + +L+++ T FE Sbjct: 453 VKFTCNKRFGGVFSTEFMTSLSLLKKDTRFE 483 >SB_20812| Best HMM Match : rve (HMM E-Value=1.2e-25) Length = 1097 Score = 29.5 bits (63), Expect = 1.7 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +1 Query: 34 AEEYIVEKILGFKYENGKEYFHVKWKGWSD 123 A + ++++L + G++ + V WKGW D Sbjct: 624 AHPFKIDRVLKTRKRGGRDEYWVHWKGWPD 653 >SB_7412| Best HMM Match : IRK (HMM E-Value=2.2e-20) Length = 610 Score = 29.5 bits (63), Expect = 1.7 Identities = 23/86 (26%), Positives = 40/86 (46%), Gaps = 2/86 (2%) Frame = +1 Query: 199 ETRFCVKIQKLKEEISFGNLLE--DNNLIERFTEFEDADLSKIKENLQLKFLSILFLTEK 372 E+ ++ +K K E N ++ DN++ ER EF+ D+ +E QL+ L F T + Sbjct: 326 ESELALRKRKYKIETEVENWIQKFDNDMGERQDEFDALDVVYTEEKKQLQELEERFKTLE 385 Query: 373 EEHCGATLVEETRDILQLYVLVRKRC 450 E + + V+VR+ C Sbjct: 386 AEVGDIRTKSQLIESHMRAVVVRRHC 411 >SB_8638| Best HMM Match : PP2C (HMM E-Value=6.5e-32) Length = 905 Score = 29.1 bits (62), Expect = 2.3 Identities = 24/105 (22%), Positives = 47/105 (44%) Frame = +1 Query: 115 WSDSENTWEPIENLDNCPAIIKNFLDEEETRFCVKIQKLKEEISFGNLLEDNNLIERFTE 294 WSD N E + + A+ + D+EE R + K E + D L +R Sbjct: 257 WSDRRNPHEVLPSYAPRFAVTVWYFDQEERRMAKEKHKGVGEFGVAVAMRDVEL-KRL-- 313 Query: 295 FEDADLSKIKENLQLKFLSILFLTEKEEHCGATLVEETRDILQLY 429 + D++++K + + + L++ E A L+++ RD L+ + Sbjct: 314 --ERDIAQVKLDSEAEQTVKKLLSDDELDAMAVLIKQARDPLEFF 356 >SB_48843| Best HMM Match : V_ATPase_I (HMM E-Value=0) Length = 1128 Score = 29.1 bits (62), Expect = 2.3 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 4/67 (5%) Frame = -3 Query: 193 HPKNFLLLQDSYLGFQ*VPKYFHYQTILSISHESILFHFHT*TLVFSQQYIL--LHFLY- 23 +PK+ +L+ D +G+ +P YF I ++ + F T +L +L +H ++ Sbjct: 528 YPKDKILMLDPKVGYSGIPYYFGLDPIWQVAKNKLNF---TNSLKMKLSIVLGVIHMMFG 584 Query: 22 -CFSFFS 5 C SFF+ Sbjct: 585 VCLSFFN 591 >SB_30175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 617 Score = 29.1 bits (62), Expect = 2.3 Identities = 22/109 (20%), Positives = 57/109 (52%), Gaps = 5/109 (4%) Frame = +1 Query: 193 EEETRFCVKIQKLKEEISFGNLLEDNNLIERFTEFEDADLSK----IKENLQLKFLSILF 360 +E+ + ++QK++EE+ LL++ ++ ++ + K ++E +LK + Sbjct: 285 QEQLQRRKQLQKMQEELKHRKLLQEQEELKHRKLLQEQEELKHRKFLQEQEELKHRKL-- 342 Query: 361 LTEKEEHC-GATLVEETRDILQLYVLVRKRCKQLMQLKEWEDHLNQVDK 504 L EKE+ L+++ ++ Q +L ++ K+ +L + ++ L Q ++ Sbjct: 343 LQEKEDEIKHRKLIQQQEELKQRELLKQQEVKKQQKLLKQQERLKQQEE 391 >SB_51384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 429 Score = 28.7 bits (61), Expect = 3.0 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 Query: 82 GKEYFHVKWKGWSDSENTWEP 144 G + V WKGW + N+W P Sbjct: 100 GARKYWVHWKGWPNKYNSWVP 120 >SB_9085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 710 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +1 Query: 169 AIIKNFLDEEETRFCVKIQKLKEEISFGNLLEDNNLIERFTEFED 303 A I ++LD + T + L+E NL++ N ++ EF + Sbjct: 382 ATIHHYLDRQPTELTNTVNALRENTYVDNLMQTGNDLDELKEFRE 426 >SB_24318| Best HMM Match : Pox_A32 (HMM E-Value=0.029) Length = 598 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +1 Query: 238 EISF-GNLLEDNNLIERFTEFEDADLSKIKENLQLK 342 +I+F G L+D NL + F +ED LSK++ +L+ Sbjct: 88 KITFAGETLQDTNLYDVFKTYEDLYLSKVEREDRLE 123 >SB_19215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1096 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +1 Query: 238 EISF-GNLLEDNNLIERFTEFEDADLSKIKENLQLK 342 +I+F G L+D NL + F +ED LSK++ +L+ Sbjct: 88 KITFAGETLQDTNLYDVFKTYEDLYLSKVEREDRLE 123 >SB_59237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 27.9 bits (59), Expect = 5.3 Identities = 23/85 (27%), Positives = 43/85 (50%), Gaps = 4/85 (4%) Frame = -2 Query: 290 VNLSMRLLSSKRLPNEISS-LSFCILTQNLVSSSSKKF-FIIAGQLSRFSIGSQVFSLSD 117 +N + +R P ++S+ SF ++ ++++SS ++ F ++ + S I + S Sbjct: 13 INKDILFSYQQRHPFQLSTKTSFPVINKDILSSYQQRHPFQLSTKTSFSVINKDILSSYQ 72 Query: 116 --HPFHFT*KYSFPFSYLNPSIFST 48 HPF T K SFP +N I S+ Sbjct: 73 QRHPFQLTTKTSFP--VINKDILSS 95 >SB_20844| Best HMM Match : Ion_trans (HMM E-Value=0) Length = 2675 Score = 27.9 bits (59), Expect = 5.3 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = -1 Query: 60 YFLNNIFFCIFYIVSL 13 YF+ +IFFC FY+++L Sbjct: 1435 YFVGSIFFCSFYLLNL 1450 >SB_18195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 27.9 bits (59), Expect = 5.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 85 KEYFHVKWKGWSDSENTWEPIENL 156 +E + +KWK W +WEP+ +L Sbjct: 154 EEQYLIKWKDWPLQFCSWEPVTHL 177 >SB_15785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 600 Score = 27.9 bits (59), Expect = 5.3 Identities = 29/95 (30%), Positives = 46/95 (48%), Gaps = 5/95 (5%) Frame = +1 Query: 205 RFCVKIQKLKEEISF--GNLLEDNNLIERFTEFED---ADLSKIKENLQLKFLSILFLTE 369 R C +++LKE+ + + + N IER ADLSK +ENL K + L + Sbjct: 141 RRCGNVEELKEKSTLLEREVNQQNKEIERILSENKVTLADLSKTQENLMKKAKELEDLQQ 200 Query: 370 KEEHCGATLVEETRDILQLYVLVRKRCKQLMQLKE 474 K T ++ R LQ +L ++ K+L +L E Sbjct: 201 KLLKQEDTAKQDKRR-LQEVILTKE--KELFKLSE 232 >SB_54236| Best HMM Match : bZIP_1 (HMM E-Value=1.1) Length = 1188 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/44 (29%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -2 Query: 374 SFSVKNSIDKNFNCKFSFILLRSASSNSVNLSMRLLSS-KRLPN 246 +F ++NS+++ C F+L + V + MR S +R PN Sbjct: 720 NFELRNSLNRASKCDGPFLLFKPLKGREVGVDMREQESLERAPN 763 >SB_45072| Best HMM Match : Kazal_2 (HMM E-Value=5.8e-06) Length = 361 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 410 EISYNYMYWLGRDVNN*C 463 E S+N+ W GRDVN C Sbjct: 118 ECSFNFFRWAGRDVNADC 135 >SB_40018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -2 Query: 254 LPNEISSLSFCILTQNLVSSSS 189 LPN+I++ C+LTQN ++ S Sbjct: 20 LPNQIAACKSCVLTQNAYTAES 41 >SB_50139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +1 Query: 238 EISF-GNLLEDNNLIERFTEFEDADLSKIKENLQLK 342 +ISF G L+D N + F +E+ LSK++ ++L+ Sbjct: 1065 KISFAGETLQDTNRYDVFKTYEELYLSKVEREVRLE 1100 >SB_47174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1198 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 43 YIVEKILGFKYENGKEYFHVKWKGWSDSENTWEPIENL 156 +IV+K+L + + + V W SD TWEP N+ Sbjct: 970 FIVKKLLNCRRRSKTTEYLVLW---SDDSQTWEPRHNI 1004 >SB_28941| Best HMM Match : PI3_PI4_kinase (HMM E-Value=2.8026e-45) Length = 2022 Score = 27.1 bits (57), Expect = 9.2 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +1 Query: 202 TRFCVKIQKLKEEISFGNLLEDNNLIERFTEFEDADLSKIKENLQL 339 +R CV+ +K+ + L D N I ++FED D ++ +LQL Sbjct: 370 SRKCVQDGTIKQAL---RLHADLNYIRALSKFEDKDFPAVQNHLQL 412 >SB_50077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 907 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +1 Query: 220 IQKLKEEISFGNLLEDNNLIERFTEFEDADLSKIKENLQLK 342 + +LK + G L+D N + FT +E+ LSK++ +L+ Sbjct: 621 VSRLKSTFA-GETLQDTNRYDVFTTYEELYLSKVEREDRLE 660 >SB_48195| Best HMM Match : DUF229 (HMM E-Value=0) Length = 1743 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -3 Query: 133 YFHYQTILSISHESILFHFHT*TLVF-SQQYILLHF 29 Y H Q+ + +++++FHF T + V + Q I +HF Sbjct: 10 YVHAQSSARLRYDALVFHFDTDSTVHTTDQSIRIHF 45 >SB_26166| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 612 Score = 27.1 bits (57), Expect = 9.2 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = -2 Query: 335 CKFSFILLRSASSNSVNLSM-RLLSSKRLPNEISSLSFCILTQN 207 C +F+ LR +S S + S+ R LPN+I++ C+LT++ Sbjct: 92 CYTAFLHLRRSSFVSSSRSLCRGADIVHLPNQIAACKSCVLTEH 135 >SB_10723| Best HMM Match : Chromo (HMM E-Value=0.031) Length = 191 Score = 27.1 bits (57), Expect = 9.2 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +1 Query: 109 KGWSDSENTWEPIENL 156 KG+S + TWEP+EN+ Sbjct: 52 KGFSPYDATWEPVENM 67 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.317 0.136 0.402 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,432,441 Number of Sequences: 59808 Number of extensions: 272736 Number of successful extensions: 1048 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 993 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1046 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -