BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30171 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g11680.1 68414.m01341 obtusifoliol 14-demethylase (CYP51) ide... 29 2.5 At3g13180.1 68416.m01649 NOL1/NOP2/sun family protein / antiterm... 28 4.3 >At1g11680.1 68414.m01341 obtusifoliol 14-demethylase (CYP51) identical to obtusifoliol 14-demethylase (GI:14624983) [Arabidopsis thaliana] Length = 488 Score = 28.7 bits (61), Expect = 2.5 Identities = 15/57 (26%), Positives = 24/57 (42%) Frame = +2 Query: 56 ALAAETGKYTPFQYNRVYSTXXPFVYKPGRYVADPGRYDPSRDNSGRYIPDNSGAYN 226 ++ A GK + +T F + DP YDP R + GR +GA++ Sbjct: 366 SVTARDGKTYDIPKGHIVATSPAFANRLPHIFKDPDTYDPERFSPGREEDKAAGAFS 422 >At3g13180.1 68416.m01649 NOL1/NOP2/sun family protein / antitermination NusB domain-containing protein low similarity to SP|P36929 SUN protein (FMU protein) {Escherichia coli}; contains Pfam profiles PF01189: NOL1/NOP2/sun family, PF01029: NusB family Length = 523 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 29 LAICLSLTVALAAETGKYTPFQYNRVYSTXXPF 127 +A LS V L+AET K +P + R T PF Sbjct: 1 MAQLLSFRVYLSAETQKASPGSFKRTQKTRKPF 33 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,592,703 Number of Sequences: 28952 Number of extensions: 135802 Number of successful extensions: 328 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 319 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 328 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -