BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30169 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16903| Best HMM Match : No HMM Matches (HMM E-Value=.) 128 4e-30 SB_55500| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=2.8e-24) 30 1.3 SB_48160| Best HMM Match : Cytochrom_C (HMM E-Value=1.8e-05) 28 4.0 SB_35585| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_19395| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_49725| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_46996| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_23894| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_2365| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_16903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 128 bits (308), Expect = 4e-30 Identities = 60/119 (50%), Positives = 75/119 (63%) Frame = +2 Query: 158 NPLFEKRPKNFAIGQGIQPTRDLSRFVRWPKYIRIQRQKAVLQRRLKVPPPINQFTQTLD 337 NPL EKRP+NF IG IQP RDLSRFVRWP+Y+++QRQK++L +RLKVPP INQFTQ LD Sbjct: 29 NPLIEKRPRNFGIGGDIQPKRDLSRFVRWPRYVKLQRQKSLLYQRLKVPPAINQFTQALD 88 Query: 338 KTTAKGLFKILEKYRPETXXXXXXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNTVTKLV 514 + + LFK+L KYRPET +P ++ G N +T LV Sbjct: 89 RQSTVQLFKLLHKYRPETKAEKKARLSAKAEKKAEGKEEAPGKKPMLVKYGINHITSLV 147 >SB_55500| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=2.8e-24) Length = 172 Score = 29.9 bits (64), Expect = 1.3 Identities = 16/53 (30%), Positives = 21/53 (39%) Frame = +2 Query: 356 LFKILEKYRPETXXXXXXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNTVTKLV 514 LFK+L KYRPET +P ++ G N +T LV Sbjct: 4 LFKLLHKYRPETKAEKKARLSAKAEKKAEGKEEAPGKKPMLVKYGINHITSLV 56 >SB_48160| Best HMM Match : Cytochrom_C (HMM E-Value=1.8e-05) Length = 212 Score = 28.3 bits (60), Expect = 4.0 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 469 PLWWRLIFLGNLSFSSFPQPLFPG 398 P WW ++F+G + FS L+PG Sbjct: 56 PKWWFMLFIGTIVFSIGYLVLYPG 79 >SB_35585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 27.9 bits (59), Expect = 5.3 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +1 Query: 280 TSASSESAPSDQPIYPDTG 336 T+ASSE+APS P PD G Sbjct: 43 TAASSEAAPSSAPSMPDYG 61 >SB_19395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 832 Score = 27.9 bits (59), Expect = 5.3 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = +2 Query: 227 SRFVRWPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEK 376 SR RW Y R+ KA+LQR ++ I Q T + K +L K Sbjct: 508 SRTFRWDPYSRMSTLKALLQRMEQLKTQIVQETCEIKKLEKLSRLVLLRK 557 >SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 27.1 bits (57), Expect = 9.2 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 274 GCTSASSESAPSDQPIYPDTGQDYS 348 GC ++ PS+ P YP T + YS Sbjct: 1229 GCRPSNDRVKPSEMPHYPKTTEKYS 1253 >SB_49725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 708 Score = 27.1 bits (57), Expect = 9.2 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = -3 Query: 376 FLQNLEKALSCSLVQCLGKLVDRRGHFQTTLKYSL 272 F+QNL L CS ++ G+LV+++ QTTL +L Sbjct: 28 FIQNLSLFL-CSFLKEHGQLVEKKVDLQTTLLEAL 61 >SB_46996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 27.1 bits (57), Expect = 9.2 Identities = 14/58 (24%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +1 Query: 151 DRESSLREEAKELCHWSGHSANS*LVQ-ICKMAQVYPHPAPEGCTSASSESAPSDQPI 321 DR ++ E KE+C+W GH + + + + + + T+++SE S +P+ Sbjct: 137 DRRKNMEERHKEMCYW-GHKFETYVTKLVSERGKRETVMGASTSTASTSEGGASAKPV 193 >SB_23894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 27.1 bits (57), Expect = 9.2 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 203 PDQWQSSLASSRREDSRS 150 PDQW+S LAS DS S Sbjct: 1 PDQWESYLASKSESDSSS 18 >SB_2365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.1 bits (57), Expect = 9.2 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 203 PDQWQSSLASSRREDSRS 150 PDQW+S LAS DS S Sbjct: 1 PDQWESYLASKSESDSSS 18 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,232,452 Number of Sequences: 59808 Number of extensions: 260842 Number of successful extensions: 750 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 694 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 750 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -