BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30169 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g62870.1 68416.m07063 60S ribosomal protein L7A (RPL7aB) 60S ... 118 2e-27 At2g47610.1 68415.m05940 60S ribosomal protein L7A (RPL7aA) 118 3e-27 At5g15920.1 68418.m01862 structural maintenance of chromosomes (... 29 2.5 At3g09210.1 68416.m01095 KOW domain-containing transcription fac... 27 5.7 >At3g62870.1 68416.m07063 60S ribosomal protein L7A (RPL7aB) 60S RIBOSOMAL PROTEIN L7A - Oryza sativa, SWISSPROT:RL7A_ORYSA Length = 256 Score = 118 bits (284), Expect = 2e-27 Identities = 51/77 (66%), Positives = 63/77 (81%) Frame = +2 Query: 158 NPLFEKRPKNFAIGQGIQPTRDLSRFVRWPKYIRIQRQKAVLQRRLKVPPPINQFTQTLD 337 NPLFE+RPK F IG + P +DLSR+++WPK IR+QRQK +L++RLKVPP +NQFT+TLD Sbjct: 20 NPLFERRPKQFGIGGALPPKKDLSRYIKWPKSIRLQRQKRILKQRLKVPPALNQFTKTLD 79 Query: 338 KTTAKGLFKILEKYRPE 388 K A LFKIL KYRPE Sbjct: 80 KNLATSLFKILLKYRPE 96 >At2g47610.1 68415.m05940 60S ribosomal protein L7A (RPL7aA) Length = 257 Score = 118 bits (283), Expect = 3e-27 Identities = 50/77 (64%), Positives = 63/77 (81%) Frame = +2 Query: 158 NPLFEKRPKNFAIGQGIQPTRDLSRFVRWPKYIRIQRQKAVLQRRLKVPPPINQFTQTLD 337 NPLFE+RPK F IG + P +DLSR+++WPK IR+QRQK +L++RLKVPP +NQFT+TLD Sbjct: 21 NPLFERRPKQFGIGGALPPKKDLSRYIKWPKSIRLQRQKRILKQRLKVPPALNQFTKTLD 80 Query: 338 KTTAKGLFKILEKYRPE 388 K A LFK+L KYRPE Sbjct: 81 KNLATSLFKVLLKYRPE 97 >At5g15920.1 68418.m01862 structural maintenance of chromosomes (SMC) family protein (MSS2) similar to SMC-related protein MSS2 [Arabidopsis thaliana] GI:9965743; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1053 Score = 28.7 bits (61), Expect = 2.5 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = -3 Query: 484 SDGIGPLWWRLIFLGNLSFSSFPQPLFPGCFSLRPVFLQNLEKALSCSLVQCL 326 + G+ P+ R +F + +S QP P CF L P L LE + +CS++ + Sbjct: 971 NQGMDPINERKMFQQLVRAAS--QPNTPQCFLLTPKLLPELEYSEACSILNIM 1021 >At3g09210.1 68416.m01095 KOW domain-containing transcription factor family protein ; est match Length = 333 Score = 27.5 bits (58), Expect = 5.7 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -3 Query: 445 LGNLSFSSFPQPLFPGCFSLRPVFLQNLEKAL 350 L N S S P+P+FPGC +R + + + ++ Sbjct: 141 LKNGSISVKPKPVFPGCIFIRCILNKEIHDSI 172 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,083,469 Number of Sequences: 28952 Number of extensions: 188428 Number of successful extensions: 546 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 532 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 546 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -