BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30166 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CY... 26 0.87 AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CY... 25 1.5 AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-tran... 25 2.0 AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 24 2.6 AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CY... 23 4.6 AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CY... 23 4.6 AY062194-1|AAL58555.1| 151|Anopheles gambiae cytochrome P450 CY... 23 4.6 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 6.1 CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline... 23 6.1 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 6.1 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 6.1 AY062193-1|AAL58554.1| 151|Anopheles gambiae cytochrome P450 CY... 23 6.1 AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 23 6.1 AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 23 6.1 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 23 6.1 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 23 6.1 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 23 6.1 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 6.1 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 23 6.1 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 23 6.1 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 23 6.1 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 23 6.1 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 23 6.1 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 23 6.1 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 23 6.1 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 23 6.1 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 23 6.1 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 8.1 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 23 8.1 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 23 8.1 AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease pr... 23 8.1 AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease pr... 23 8.1 AF203335-1|AAF19830.1| 175|Anopheles gambiae immune-responsive ... 23 8.1 >AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CYPm3r10 protein. Length = 441 Score = 25.8 bits (54), Expect = 0.87 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 170 EMQHLDNMMKELSLKFPSIINEGRVEGDKYQI 265 EM +LD ++KE K+P + R +YQ+ Sbjct: 292 EMNYLDQILKESLRKYPPVPVHFRETSKEYQV 323 >AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CYP6M1 protein. Length = 503 Score = 25.0 bits (52), Expect = 1.5 Identities = 9/33 (27%), Positives = 20/33 (60%) Frame = +2 Query: 167 NEMQHLDNMMKELSLKFPSIINEGRVEGDKYQI 265 ++M++LD ++KE K+P + R+ Y++ Sbjct: 350 HDMKYLDQILKESLRKYPPVPMHFRMTAQDYRV 382 >AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-transferase D8 protein. Length = 224 Score = 24.6 bits (51), Expect = 2.0 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +2 Query: 95 HYDPFSPYVRESMLDTHSLWSNLANEMQHLDNMMKELSLK 214 +Y P SPY R ML +L L+ +Q +D +MK+ L+ Sbjct: 4 YYHPASPYCRSVMLVAKAL--KLSLNLQFVD-LMKDEQLR 40 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 24.2 bits (50), Expect = 2.6 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +2 Query: 170 EMQHLDNMMKELSLKFPSIINEGRVEGDKYQISIHLPG 283 EM++LD ++ E K+P + RV Y H+PG Sbjct: 352 EMKYLDQILNESLRKYPPVPVHLRVASKDY----HVPG 385 >AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CYP4C27 protein. Length = 150 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +2 Query: 167 NEMQHLDNMMKELSLKFPSIINEGRVEGDKYQISIH 274 NE++ L+ +KE +PS+ GR + Q+ H Sbjct: 56 NELKLLERCIKEALRLYPSVSFFGRTLSEDVQLGGH 91 >AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CYP4D17 protein. Length = 151 Score = 23.4 bits (48), Expect = 4.6 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 161 LANEMQHLDNMMKELSLKFPSIINEGR 241 + N+M +LD ++KE +PS+ GR Sbjct: 54 MLNDMHYLDLVIKETLRLYPSVPMIGR 80 >AY062194-1|AAL58555.1| 151|Anopheles gambiae cytochrome P450 CYP4D16 protein. Length = 151 Score = 23.4 bits (48), Expect = 4.6 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 161 LANEMQHLDNMMKELSLKFPSIINEGR 241 + N+M +LD ++KE +PS+ GR Sbjct: 54 MLNDMHYLDLVIKETLRLYPSVPMFGR 80 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 6.1 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 4/37 (10%) Frame = +1 Query: 334 AG*QCF*SLLENTEPSL----GCEFRRQLGLRERRVE 432 AG F +++ ++ PS+ G E +Q+GL ERRV+ Sbjct: 540 AGKTTFSNIIGSSGPSVTSCTGSEIDKQVGLWERRVK 576 >CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline phosphatase protein. Length = 548 Score = 23.0 bits (47), Expect = 6.1 Identities = 10/25 (40%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = +2 Query: 80 HWPYHHYDPFSPYV--RESMLDTHS 148 HW +HH S YV R +L+T++ Sbjct: 298 HWQHHHSHHRSAYVQNRVQLLETNT 322 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.0 bits (47), Expect = 6.1 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +2 Query: 140 THSLWSNLANEMQHLDNMMKELSLKFPSIINEGRVE 247 +H L+ L NE+ ++ + +L F S I+ R+E Sbjct: 1486 SHRLYDVLGNEIGRINKLGSIENLSFQSRISNCRIE 1521 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.0 bits (47), Expect = 6.1 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +2 Query: 140 THSLWSNLANEMQHLDNMMKELSLKFPSIINEGRVE 247 +H L+ L NE+ ++ + +L F S I+ R+E Sbjct: 1487 SHRLYDVLGNEIGRINKLGSIENLSFQSRISNCRIE 1522 >AY062193-1|AAL58554.1| 151|Anopheles gambiae cytochrome P450 CYP4D15 protein. Length = 151 Score = 23.0 bits (47), Expect = 6.1 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 161 LANEMQHLDNMMKELSLKFPSIINEGR 241 + N+M +LD ++KE +PS+ GR Sbjct: 54 MLNDMHYLDLVIKETLRLYPSVPLFGR 80 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 23.0 bits (47), Expect = 6.1 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = +2 Query: 221 SIIN---EGRVEGDKYQISIHLPGYEQKDINVKAKN 319 S+IN E R+ G +L E+ INVKAKN Sbjct: 107 SVINASSEYRINGSVVSPQHYLAELEKIGINVKAKN 142 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 23.0 bits (47), Expect = 6.1 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +1 Query: 19 SVVRTAGGGLGRATVLPWLVTLAVSPLRPLQS 114 S V A GL T PWLVT + S L+ S Sbjct: 83 SSVGGAQSGLPDITRHPWLVTASQSALQKFAS 114 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.0 bits (47), Expect = 6.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 68 HGSSHWPYHHY 100 HG SH +HHY Sbjct: 222 HGPSHLSHHHY 232 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 23.0 bits (47), Expect = 6.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 68 HGSSHWPYHHY 100 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 6.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 68 HGSSHWPYHHY 100 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.0 bits (47), Expect = 6.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 68 HGSSHWPYHHY 100 HG SH +HHY Sbjct: 224 HGPSHLSHHHY 234 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.0 bits (47), Expect = 6.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 68 HGSSHWPYHHY 100 HG SH +HHY Sbjct: 229 HGPSHLSHHHY 239 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 6.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 68 HGSSHWPYHHY 100 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.0 bits (47), Expect = 6.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 68 HGSSHWPYHHY 100 HG SH +HHY Sbjct: 229 HGPSHLSHHHY 239 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 23.0 bits (47), Expect = 6.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 68 HGSSHWPYHHY 100 HG SH +HHY Sbjct: 253 HGPSHLSHHHY 263 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 6.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 68 HGSSHWPYHHY 100 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.0 bits (47), Expect = 6.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 68 HGSSHWPYHHY 100 HG SH +HHY Sbjct: 222 HGPSHLSHHHY 232 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.0 bits (47), Expect = 6.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 68 HGSSHWPYHHY 100 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 23.0 bits (47), Expect = 6.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 68 HGSSHWPYHHY 100 HG SH +HHY Sbjct: 229 HGPSHLSHHHY 239 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.0 bits (47), Expect = 6.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 68 HGSSHWPYHHY 100 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 22.6 bits (46), Expect = 8.1 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +2 Query: 74 SSHWPYHHYDPFSPYVRES 130 ++++P+H Y+P S VR S Sbjct: 68 NANYPWHVYEPSSLIVRSS 86 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 22.6 bits (46), Expect = 8.1 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +2 Query: 59 QYYHGSSHWPYHHYDPFSPYVRESMLDTH 145 Q +H S H P HH + P +M H Sbjct: 132 QQHHPSVHHPAHHPLHYQPAAAAAMHHHH 160 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 22.6 bits (46), Expect = 8.1 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +2 Query: 158 NLANEMQHLDNMMKELSLKFPSIINEGRVEGDKYQI 265 ++ +Q+LD+++ E K+P I + RV Y + Sbjct: 355 DMVMNVQYLDSVINETLRKYPPIESLSRVPMRDYTV 390 >AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease protein. Length = 375 Score = 22.6 bits (46), Expect = 8.1 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +2 Query: 20 VLCGLLAAVSAAPQYYHGSSHWP 88 V CGLL + A HG H P Sbjct: 7 VACGLLCLLVIAIDQGHGQEHKP 29 >AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease protein. Length = 364 Score = 22.6 bits (46), Expect = 8.1 Identities = 15/74 (20%), Positives = 38/74 (51%), Gaps = 2/74 (2%) Frame = +2 Query: 278 PGYEQKDINVKAKNGVLMVQANSAFNHYLKIQNLPWDVNSEGSWVYEKDVLKIT--FPLK 451 P Y+ +I+ +L + ++ FN Y++ LP+D + + + + ++ +T + Sbjct: 200 PEYDMHNISRPNDICILRLASDVTFNDYVRPICLPFDPDVQQLPIVD-EIFTVTGWGETE 258 Query: 452 QKQPEDSKRPVAEP 493 ++P D+++ V P Sbjct: 259 DRRPSDTQKHVELP 272 >AF203335-1|AAF19830.1| 175|Anopheles gambiae immune-responsive serine protease-relatedprotein ISPR20 protein. Length = 175 Score = 22.6 bits (46), Expect = 8.1 Identities = 10/41 (24%), Positives = 20/41 (48%) Frame = +2 Query: 269 IHLPGYEQKDINVKAKNGVLMVQANSAFNHYLKIQNLPWDV 391 +H+P YE + + +G++ N+ F+ + PW V Sbjct: 106 VHIPPYEIEGCGHRNPHGMIFTIENNQFSE-SEYGEYPWTV 145 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 548,527 Number of Sequences: 2352 Number of extensions: 11189 Number of successful extensions: 90 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 90 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -