BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30166 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 21 7.5 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 7.5 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 7.5 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 461 PEDSKRPVAEPTETTST 511 P + P EP+ TTST Sbjct: 380 PTTTASPTTEPSTTTST 396 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 Query: 400 RQLGLRERRVENHLPA 447 R++ L ERR ++HL A Sbjct: 230 RRIVLEERRAQSHLEA 245 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = +2 Query: 110 SPYVRESMLDTHSLWSNLANEMQHLDNMMKELS 208 SP +S + HSL+ + H D+ + S Sbjct: 84 SPTQLQSFMQQHSLYLQQQQQQHHQDSSSEHAS 116 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,032 Number of Sequences: 438 Number of extensions: 3013 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -