BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30162 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 97 9e-23 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.35 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 4.3 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 5.7 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 21 5.7 AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 21 7.5 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 10.0 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 21 10.0 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 97.1 bits (231), Expect = 9e-23 Identities = 45/90 (50%), Positives = 64/90 (71%) Frame = +2 Query: 29 EINPDGSYTYFYETNNGIAAQEQGVPRNLGGNPPAVPVVAQGSFSWTSPEGVPISVNYVA 208 E+N DG+Y +ET+NGI+ QE G P+ + PVV+QGS S+T+P+G +S+ YVA Sbjct: 35 EVNFDGNYINNFETSNGISHQESGQPKQVDNE---TPVVSQGSDSYTAPDGQQVSITYVA 91 Query: 209 DENGYQPTGNAIPTSPPVPEQIARALAYIA 298 DENG+Q G+ IPT+PP+P +I RAL + A Sbjct: 92 DENGFQVQGSHIPTAPPIPPEIQRALEWNA 121 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 25.4 bits (53), Expect = 0.35 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +2 Query: 173 PEGVP-ISVNYVADENGYQPTGNAIPTSPPVPEQIARA 283 PE VP + ++ + G G+ TSPP P I+RA Sbjct: 1369 PERVPTVDLSPSPSDRGRNDDGSDRLTSPPTPLSISRA 1406 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.8 bits (44), Expect = 4.3 Identities = 8/21 (38%), Positives = 9/21 (42%) Frame = +1 Query: 244 PHFPTSA*ADRSCSCLHRQEH 306 P PT D C+ LH H Sbjct: 455 PQLPTEESVDALCNTLHHWHH 475 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -1 Query: 168 VQENEPCATTGTAGGFPPRLRGTPCS 91 V ++E + T TAG FP + T S Sbjct: 714 VSKHEEVSRTSTAGQFPTNVATTVTS 739 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 21.4 bits (43), Expect = 5.7 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 8 ETVKFGNEINPDGSYTYFYET 70 E +KF N P G T F+E+ Sbjct: 236 EIIKFVNIFFPGGKKTTFFES 256 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 21.0 bits (42), Expect = 7.5 Identities = 10/35 (28%), Positives = 15/35 (42%) Frame = +2 Query: 137 PVVAQGSFSWTSPEGVPISVNYVADENGYQPTGNA 241 P A S ++ +VNY N PTG++ Sbjct: 34 PATASLESSLSAAAVAAAAVNYAQQHNSPSPTGSS 68 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 20.6 bits (41), Expect = 10.0 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +2 Query: 14 VKFGNEINPDGSYTYFY 64 V+FG + +P+G Y Y Sbjct: 433 VRFGRKADPNGDYIRRY 449 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 143 RREQQGGFHQGYVELPVLGQ 84 R++QQ HQG V P+ Q Sbjct: 224 RQQQQAQQHQGVVTSPLSQQ 243 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,127 Number of Sequences: 438 Number of extensions: 4103 Number of successful extensions: 9 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -