SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV30157
         (370 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_01_0777 + 6004370-6004559,6005089-6005207,6005411-6005538,600...    27   6.1  

>07_01_0777 +
           6004370-6004559,6005089-6005207,6005411-6005538,
           6005645-6005749,6007156-6008650
          Length = 678

 Score = 26.6 bits (56), Expect = 6.1
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +3

Query: 93  YMSDKI*RAVYLIEYIQENMNNVSLKIRMSDND 191
           YM DK  + +YL+EYI + + +VSLK     +D
Sbjct: 327 YMEDKTIKWIYLLEYIHK-IVSVSLKQIQEQHD 358


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 6,444,306
Number of Sequences: 37544
Number of extensions: 94463
Number of successful extensions: 153
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 153
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 153
length of database: 14,793,348
effective HSP length: 74
effective length of database: 12,015,092
effective search space used: 576724416
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -