BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30153 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15319| Best HMM Match : Transposase_9 (HMM E-Value=3.2) 31 0.56 SB_13174| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_44616| Best HMM Match : rve (HMM E-Value=0.012) 29 3.0 SB_19217| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_56854| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_24050| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_47225| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_20133| Best HMM Match : Extensin_2 (HMM E-Value=2.1) 27 6.9 SB_36835| Best HMM Match : AMP-binding (HMM E-Value=6.2e-13) 27 6.9 SB_25577| Best HMM Match : Mab-21 (HMM E-Value=1e-05) 27 6.9 SB_47005| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_45985| Best HMM Match : IQ (HMM E-Value=1.7e-37) 27 9.2 SB_24712| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_20652| Best HMM Match : OmpH (HMM E-Value=1.9) 27 9.2 SB_12593| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_50077| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_2018| Best HMM Match : AIRC (HMM E-Value=5.1) 27 9.2 >SB_15319| Best HMM Match : Transposase_9 (HMM E-Value=3.2) Length = 782 Score = 31.1 bits (67), Expect = 0.56 Identities = 23/94 (24%), Positives = 40/94 (42%) Frame = -1 Query: 375 RLMLPRGTEGGFPFQLFVFVYPFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPN 196 R L + G +P QL + V PF KG P++ + + F + R N Sbjct: 333 RRWLSEPSYGYWPQQLNLAVCPFTQKGN---PYKKAAFERLCIEFGMSRKPDFRWKGGRN 389 Query: 195 MYFKDIFIYHEGERFPYKFNLPSYDTQSNVVPKN 94 D+F+++ GE + + YDT ++ P + Sbjct: 390 HGLGDVFVFYPGEGYRNVHVIRGYDTAADEYPSH 423 >SB_13174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1108 Score = 29.1 bits (62), Expect = 2.3 Identities = 18/73 (24%), Positives = 31/73 (42%) Frame = -1 Query: 312 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNL 133 PF KG P++ + + F L R N D+F+++ GE + + Sbjct: 155 PFTQKGN---PYKKAAFERLCIEFGLPRKPDFRWKGGRNHGLDDVFVFYPGEGYRNMHVI 211 Query: 132 PSYDTQSNVVPKN 94 P YDT ++ P + Sbjct: 212 PGYDTAADEYPSH 224 >SB_44616| Best HMM Match : rve (HMM E-Value=0.012) Length = 1189 Score = 28.7 bits (61), Expect = 3.0 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 1/86 (1%) Frame = -1 Query: 348 GGFPFQLFVFVYPFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFK-DIFI 172 G +P QL V PF KG P++ + + F L R D +K + D+F+ Sbjct: 376 GYWPQQLNFAVCPFTQKGN---PYKKAAFERLCIEFSLPRKP-DFRWKGGRNHGPGDVFV 431 Query: 171 YHEGERFPYKFNLPSYDTQSNVVPKN 94 ++ GE + + YDT ++ P + Sbjct: 432 FYPGEGYRNVHVILGYDTAADEYPSH 457 >SB_19217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 28.7 bits (61), Expect = 3.0 Identities = 23/85 (27%), Positives = 36/85 (42%) Frame = -1 Query: 348 GGFPFQLFVFVYPFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIY 169 G +P QL V PF KG P++ V + + F L R N D+F++ Sbjct: 238 GYWPQQLNFAVCPFTQKGN---PYKKAVFERLCIEFGLPRNPDFRWKGGRNHGLGDVFVF 294 Query: 168 HEGERFPYKFNLPSYDTQSNVVPKN 94 + GE + YDT ++ P + Sbjct: 295 YPGEGNRNVHVIRGYDTAADEYPSH 319 >SB_56854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -2 Query: 233 IAPLLMHYSRFLTCISRIFSFTTRVNGSLTNSIFLRMTHS 114 I PL+ L C+S + T ++GSL++ + ++TH+ Sbjct: 45 ILPLVPRPKELLECVSNMRLLTWLLHGSLSHMVHSKITHA 84 >SB_24050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1092 Score = 28.3 bits (60), Expect = 4.0 Identities = 19/73 (26%), Positives = 31/73 (42%) Frame = -1 Query: 312 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNL 133 PF KGK P++ + + F L R L N D+F+++ GE + + Sbjct: 203 PFTQKGK---PYKKAAFERLCIEFGLPRKPDFRLKGGRNHGLGDVFVFYPGEGYRNVHVI 259 Query: 132 PSYDTQSNVVPKN 94 YDT + P + Sbjct: 260 RGYDTAMDEYPSH 272 >SB_47225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 27.5 bits (58), Expect = 6.9 Identities = 18/73 (24%), Positives = 31/73 (42%) Frame = -1 Query: 312 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNL 133 PF KG P++ + + F L R N D+F+++ GER+ + Sbjct: 186 PFTQKGN---PYKKAAFERLCIEFGLPRKPDFRWKGGRNHGLGDVFVFYPGERYRNVHVI 242 Query: 132 PSYDTQSNVVPKN 94 YDT ++ P + Sbjct: 243 RGYDTAADEYPSH 255 >SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1967 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = +3 Query: 210 IMHQQRGDPEGSQEAYCQEQKIRKEPSPCLCCRMDRRKQRA 332 ++HQ++ E Q++ C E+++ +E + L C + KQRA Sbjct: 1623 LLHQEKLLKEKQQQSACVEKQVEQELA-LLRCELAEAKQRA 1662 >SB_20133| Best HMM Match : Extensin_2 (HMM E-Value=2.1) Length = 762 Score = 27.5 bits (58), Expect = 6.9 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -1 Query: 471 KEDSVPMTEIMKMLDEGKVPFDMSEEFCYMPKRLMLPRGTEGG 343 K++ TE LDE K D+ E Y K+ +P+GT+ G Sbjct: 592 KKEVSAATESKDALDETKKCKDLPVENAYENKKNYVPQGTQAG 634 >SB_36835| Best HMM Match : AMP-binding (HMM E-Value=6.2e-13) Length = 874 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 310 WIDENKELEWESTFSTSRQHESFRHVTELFRHIKRYFSF-VEHLHN 444 W D KEL F S H+ F ++T+ + + +Y F V +H+ Sbjct: 402 WGDRLKELIKYKGFQVSTIHDRFGYITDRLKELIKYKGFQVSAIHD 447 >SB_25577| Best HMM Match : Mab-21 (HMM E-Value=1e-05) Length = 492 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 331 LEWESTFSTSRQHESFRHVTELFRH 405 LEW +FS + + F H+TEL RH Sbjct: 369 LEWRLSFSNAEK-TLFAHMTELMRH 392 >SB_47005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 289 Score = 27.1 bits (57), Expect = 9.2 Identities = 18/73 (24%), Positives = 31/73 (42%) Frame = -1 Query: 312 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNL 133 PF KG P++ + + F L R V N D+F+++ GE + + Sbjct: 177 PFTQKGN---PYKKAAFERLCIEFGLPRKQVFRWKGGRNHGLGDVFVFYPGEGYCNVHVI 233 Query: 132 PSYDTQSNVVPKN 94 YDT ++ P + Sbjct: 234 RGYDTAADEYPSH 246 >SB_45985| Best HMM Match : IQ (HMM E-Value=1.7e-37) Length = 942 Score = 27.1 bits (57), Expect = 9.2 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 282 PFESFVLDNKPLGFPLDRPV 223 PF+ FV K +GFP+ +PV Sbjct: 250 PFDDFVKRYKVIGFPMHKPV 269 >SB_24712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 27.1 bits (57), Expect = 9.2 Identities = 18/73 (24%), Positives = 32/73 (43%) Frame = -1 Query: 312 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNL 133 PF KG P++ + + F L R + N D+F+++ GE + + Sbjct: 179 PFTQKGN---PYKKAAFERLCIEFGLPRKLDFRWKGGRNHGLGDVFVFYPGEGYRNVHVI 235 Query: 132 PSYDTQSNVVPKN 94 SYDT ++ P + Sbjct: 236 CSYDTAADEYPSH 248 >SB_20652| Best HMM Match : OmpH (HMM E-Value=1.9) Length = 842 Score = 27.1 bits (57), Expect = 9.2 Identities = 21/76 (27%), Positives = 33/76 (43%), Gaps = 3/76 (3%) Frame = -1 Query: 312 PFDNKGKDL--APFESFVLD-NKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYK 142 PF KG A FE ++ P G P++R N D+F+++ GER Sbjct: 132 PFTQKGNPYKKAAFERLCIEFGLPPGLPMERR--------RNHGLGDVFVFYPGERCRNV 183 Query: 141 FNLPSYDTQSNVVPKN 94 + YDT ++ P + Sbjct: 184 HVIRGYDTAADKYPSH 199 >SB_12593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 27.1 bits (57), Expect = 9.2 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -1 Query: 183 DIFIYHEGERFPYKFNLPSYDTQSNVVPKN 94 D+F+++ GE + +P YDT ++ P + Sbjct: 259 DVFVFYPGEGYRNVHVIPGYDTAADEYPSH 288 >SB_50077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 907 Score = 27.1 bits (57), Expect = 9.2 Identities = 20/76 (26%), Positives = 33/76 (43%), Gaps = 3/76 (3%) Frame = -1 Query: 312 PFDNKGKDL--APFESFVLD-NKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYK 142 PF KG A FE ++ P G P++R L D+F+++ GE + Sbjct: 128 PFTQKGNPYKKAAFERLCIEFGLPPGLPMERRAEHGL--------GDVFVFYPGEGYRNV 179 Query: 141 FNLPSYDTQSNVVPKN 94 + YDT ++ P + Sbjct: 180 HVIRGYDTAADEYPSH 195 >SB_2018| Best HMM Match : AIRC (HMM E-Value=5.1) Length = 298 Score = 27.1 bits (57), Expect = 9.2 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -1 Query: 183 DIFIYHEGERFPYKFNLPSYDTQSNVVPKN 94 D+F+++ GE + +P YDT ++ P + Sbjct: 253 DVFVFYPGEGYRNVHVIPGYDTAADEYPSH 282 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,854,421 Number of Sequences: 59808 Number of extensions: 347649 Number of successful extensions: 1067 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 995 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1066 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -