BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30151 (516 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL032653-3|CAA21713.1| 861|Caenorhabditis elegans Hypothetical ... 29 2.0 AC025726-9|AAK73924.1| 594|Caenorhabditis elegans Hypothetical ... 27 8.0 >AL032653-3|CAA21713.1| 861|Caenorhabditis elegans Hypothetical protein Y54E5B.2 protein. Length = 861 Score = 29.1 bits (62), Expect = 2.0 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 150 SHIDTVVGIIIMTRDNCRSVSCDILDKTHSV 242 SH+ TVVGI++ R+ +VS D T S+ Sbjct: 792 SHLSTVVGIVVTDRNRIHTVSLDCAVVTSSM 822 >AC025726-9|AAK73924.1| 594|Caenorhabditis elegans Hypothetical protein Y71G12B.23a protein. Length = 594 Score = 27.1 bits (57), Expect = 8.0 Identities = 15/58 (25%), Positives = 27/58 (46%), Gaps = 4/58 (6%) Frame = -2 Query: 287 MYRFINLMFNNLNRANRMRFI*NITTHAATVITCHNNYTYYRINM*CG----NILWNV 126 +Y F L+F N+ ++R+ +I AA + +YT + CG N+ W + Sbjct: 430 VYHFCELLFRQQNKHRKLRYYLHICDRAAIYLFIAASYTPWLTLRHCGLPGLNLKWMI 487 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,945,713 Number of Sequences: 27780 Number of extensions: 204241 Number of successful extensions: 342 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 342 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 342 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -