BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30144 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 27 0.38 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 25 2.0 AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein p... 25 2.0 EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 23 6.1 CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein ... 23 6.1 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 23 8.1 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 23 8.1 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 23 8.1 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 27.1 bits (57), Expect = 0.38 Identities = 13/65 (20%), Positives = 29/65 (44%) Frame = +3 Query: 273 DHRGSLRRQTPTEGPGTLGVHRQTRDREIRSRREAKETGLRLKRAQRKTKAATEAQSSQE 452 +HR + R+ + ++RE+R +RE ++ + +++ K E Q ++ Sbjct: 446 EHRAARLREEERAREAREAAIEREKERELREQREREQREKEQREKEQREKEERERQQREK 505 Query: 453 GSRPR 467 R R Sbjct: 506 EQRER 510 Score = 25.0 bits (52), Expect = 1.5 Identities = 16/67 (23%), Positives = 35/67 (52%) Frame = +1 Query: 43 KKQRDIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKE 222 +K+R++ E+R+R E+ EK+++ Q K+ + Q++ E + ER +E Sbjct: 469 EKERELREQRER-EQREKEQREKEQREKEERERQQREKEQREREQ---REKEREREAARE 524 Query: 223 QLEEEKK 243 + E ++ Sbjct: 525 RERERER 531 Score = 25.0 bits (52), Expect = 1.5 Identities = 10/43 (23%), Positives = 25/43 (58%) Frame = +1 Query: 346 ETEKYDLEERQKRQDYDLKELKERQKQQLRHKALKKGLDPEAL 474 E E+ + E+R+K ++ + +ER++++ R + + P +L Sbjct: 504 EKEQREREQREKEREREAARERERERERERERERMMHMMPHSL 546 Score = 23.4 bits (48), Expect = 4.6 Identities = 22/108 (20%), Positives = 44/108 (40%) Frame = +1 Query: 145 PNFTIQKKSENFGLSNAQLERNKTKEQLEEEKKISLSIRIKPLTIEGLSVDKLRQKAQEL 324 P +Q E L +E+ E + + R K + + R+K Q Sbjct: 430 PGMGMQSIHERMKLEEEHRAARLREEERAREAREAAIEREKERELREQREREQREKEQRE 489 Query: 325 WECIVKLETEKYDLEERQKRQDYDLKELKERQKQQLRHKALKKGLDPE 468 E + E E+ + ++R+K Q + KER+++ R + ++ + E Sbjct: 490 KE---QREKEERERQQREKEQREREQREKEREREAARERERERERERE 534 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 24.6 bits (51), Expect = 2.0 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 339 QTRDREIRSRREAKETGLRLKRAQRKTKAATEAQSSQ 449 + R R +RE KET +R ++ QR+ K A+ Q Sbjct: 240 EDRQRFDNYKRELKETMIRNQQLQRQRKQELIAEEQQ 276 >AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein protein. Length = 400 Score = 24.6 bits (51), Expect = 2.0 Identities = 12/50 (24%), Positives = 21/50 (42%) Frame = +3 Query: 339 QTRDREIRSRREAKETGLRLKRAQRKTKAATEAQSSQEGSRPRSAHRQAP 488 QTR + ++ R + AQR+T ++ QS Q + + P Sbjct: 121 QTRKGRVPKEARKRDNNARQRSAQRETPKSSGGQSKQPKKKKKKRSLPKP 170 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 23.0 bits (47), Expect = 6.1 Identities = 6/11 (54%), Positives = 10/11 (90%) Frame = -3 Query: 325 RVPGPSVGVCR 293 ++PGP++ VCR Sbjct: 110 KIPGPTISVCR 120 >CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein protein. Length = 277 Score = 23.0 bits (47), Expect = 6.1 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -3 Query: 262 CGWTGRSSSPLPAAPWSC 209 CG R S P A W+C Sbjct: 183 CGQVERKSQPFGPARWAC 200 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 119 P*KMPARPDPTSPSKRR 169 P +P RP P S KRR Sbjct: 406 PSTLPTRPSPKSSRKRR 422 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 22.6 bits (46), Expect = 8.1 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +1 Query: 49 QRDIEEKRQRLEEAEK 96 ++D+EEKR RL+ E+ Sbjct: 519 EKDLEEKRARLQTLEE 534 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 22.6 bits (46), Expect = 8.1 Identities = 13/64 (20%), Positives = 29/64 (45%) Frame = +3 Query: 321 TLGVHRQTRDREIRSRREAKETGLRLKRAQRKTKAATEAQSSQEGSRPRSAHRQAPAQNS 500 T+G+ ++ ++ R + + + +LK AQR+ + A E +E ++ N+ Sbjct: 85 TVGIVKRLEEQIQLLRLQMEASNEQLKEAQREAREAREDARVREAEHREELRKEKELFNA 144 Query: 501 SSVQ 512 Q Sbjct: 145 LLAQ 148 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.308 0.126 0.333 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 372,893 Number of Sequences: 2352 Number of extensions: 5723 Number of successful extensions: 72 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.6 bits)
- SilkBase 1999-2023 -