BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30141 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21904| Best HMM Match : Vinculin (HMM E-Value=0) 31 0.74 SB_46239| Best HMM Match : Phage_integrase (HMM E-Value=0.24) 30 1.3 SB_56175| Best HMM Match : RRM_1 (HMM E-Value=0.27) 29 3.0 SB_9680| Best HMM Match : Ank (HMM E-Value=4e-20) 28 4.0 SB_40843| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_31796| Best HMM Match : SAP (HMM E-Value=3.5e-10) 27 6.9 SB_48548| Best HMM Match : HPPK (HMM E-Value=3.9e-09) 27 9.2 SB_49668| Best HMM Match : S-antigen (HMM E-Value=1.6e-08) 27 9.2 >SB_21904| Best HMM Match : Vinculin (HMM E-Value=0) Length = 999 Score = 30.7 bits (66), Expect = 0.74 Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = +3 Query: 111 SQCTKNNAEDKV-PEVEAALRTFGNCLKGLVDLNVLKTEIEEAKPNGALDEVFKKYCDKS 287 + CT++N D++ E A + + L + K ++A P G LD+ +K C K+ Sbjct: 327 ADCTRDNTRDRIIAECNAVRQALQDLLSEYMSHAGGK---KKAVPGGPLDKAIEKMCSKT 383 Query: 288 AQLKG 302 + L+G Sbjct: 384 SGLRG 388 >SB_46239| Best HMM Match : Phage_integrase (HMM E-Value=0.24) Length = 364 Score = 29.9 bits (64), Expect = 1.3 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 387 WYCFGHH*CGSHSRCLHKDAR 325 W+C+G+ G SRC+H+ R Sbjct: 302 WFCWGYFSYGESSRCIHRGVR 322 >SB_56175| Best HMM Match : RRM_1 (HMM E-Value=0.27) Length = 601 Score = 28.7 bits (61), Expect = 3.0 Identities = 23/74 (31%), Positives = 32/74 (43%), Gaps = 1/74 (1%) Frame = +3 Query: 15 FLVTMMWKTVLITIFAAGVLADDFSQITAVVTSQCTKNNAEDKVPEVEAALRTFGNCLKG 194 FL + ++++ GV D +S I +V N A D + EVE A R Sbjct: 284 FLKVLKGAGAVLSVIGIGV--DLYSIINTLVECDKKSNQAADAIKEVEKAEREVSKSETE 341 Query: 195 LVDLNV-LKTEIEE 233 L D N LKT + E Sbjct: 342 LRDFNTELKTFMRE 355 >SB_9680| Best HMM Match : Ank (HMM E-Value=4e-20) Length = 1243 Score = 28.3 bits (60), Expect = 4.0 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -3 Query: 253 SAPFGLASSISVFRTFKSTSPLRQFP 176 S PFG+ S+ S+ + F S + L++FP Sbjct: 458 SLPFGIQSASSLVKLFLSNNKLKEFP 483 >SB_40843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 27.9 bits (59), Expect = 5.3 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +3 Query: 177 GNCLKGLVDLNVLKTEIEE 233 GNCLKG+V++NV IE+ Sbjct: 277 GNCLKGIVNVNVSPNIIEQ 295 >SB_31796| Best HMM Match : SAP (HMM E-Value=3.5e-10) Length = 1029 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +1 Query: 235 PSQTVHSTRFSRSTVTRVLN*KA-VSARCCRACVLV*ATTMRTTSMMPKT 381 P+ + S + + K+ + RCCR CV TT +TT + K+ Sbjct: 13 PNAAIESQELTHQQILNNREGKSCTTTRCCRRCVGKKITTQKTTGAVDKS 62 >SB_48548| Best HMM Match : HPPK (HMM E-Value=3.9e-09) Length = 170 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = +1 Query: 112 RNAPRTM---LKTKSLKLKQHCVPLETASRDWSI 204 +NAPRT+ + K Q+C+P+ ++S WS+ Sbjct: 59 KNAPRTIDLDISFNGSKEIQYCLPIGSSSTTWSL 92 >SB_49668| Best HMM Match : S-antigen (HMM E-Value=1.6e-08) Length = 531 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/53 (24%), Positives = 25/53 (47%) Frame = +3 Query: 285 SAQLKGCISSVLQGVRPCVGNDYANHINDAQNSTNQLIDFVCYKDGDRIALFI 443 S L+G S+ LQG + +H+ + +ID C + +++ LF+ Sbjct: 402 STALQGTNSTALQGTNSTTLQGHCDHVAKVPWPVSVVIDEACQRKYNQVLLFL 454 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,536,216 Number of Sequences: 59808 Number of extensions: 312745 Number of successful extensions: 839 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 794 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 839 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -