BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30141 (516 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL353779-1|CAI20975.1| 250|Homo sapiens chromosome 1 open readi... 29 7.3 AF005081-1|AAB83961.1| 112|Homo sapiens skin-specific protein p... 29 7.3 >AL353779-1|CAI20975.1| 250|Homo sapiens chromosome 1 open reading frame 68 protein. Length = 250 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = -3 Query: 337 QGRTPCSTELIQPFS*ALLSQYFLKTSSSAPFGLASSISVFRTFKSTSPLRQF 179 QG +PC + +Q + SQY + SAP + RTF SPLR++ Sbjct: 135 QGASPCQSYYVQAPASGSTSQYCVTDPCSAPCSTSYCCLAPRTF-GVSPLRRW 186 >AF005081-1|AAB83961.1| 112|Homo sapiens skin-specific protein protein. Length = 112 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = -3 Query: 337 QGRTPCSTELIQPFS*ALLSQYFLKTSSSAPFGLASSISVFRTFKSTSPLRQF 179 QG +PC + +Q + SQY + SAP + RTF SPLR++ Sbjct: 5 QGASPCQSYYVQAPASGSTSQYCVTDPCSAPCSTSYCCLAPRTF-GVSPLRRW 56 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,376,407 Number of Sequences: 237096 Number of extensions: 1365692 Number of successful extensions: 3369 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3256 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3369 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4876707572 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -