BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30139 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 prot... 24 0.92 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 6.5 DQ855498-1|ABH88185.1| 127|Tribolium castaneum chemosensory pro... 21 8.6 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 21 8.6 AJ973445-1|CAJ01492.1| 127|Tribolium castaneum hypothetical pro... 21 8.6 >DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 protein. Length = 383 Score = 23.8 bits (49), Expect = 0.92 Identities = 8/17 (47%), Positives = 14/17 (82%) Frame = -2 Query: 98 DLRVVLCRGGSDDGSHK 48 DL+++L GG ++GS+K Sbjct: 92 DLKIILSMGGWNEGSYK 108 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.0 bits (42), Expect = 6.5 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -2 Query: 98 DLRVVLCRGGSDDGSHKGESYNDDQFHFNSF 6 DL+++L GG GS + + F N F Sbjct: 589 DLKILLAIGGWAFGSTPFKELTSNVFRMNQF 619 >DQ855498-1|ABH88185.1| 127|Tribolium castaneum chemosensory protein 12 protein. Length = 127 Score = 20.6 bits (41), Expect = 8.6 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = -3 Query: 463 IKLITSNKRMWW 428 I+ + NKR WW Sbjct: 88 IRYLIKNKRDWW 99 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 20.6 bits (41), Expect = 8.6 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +2 Query: 401 LIQDCVAKHPPHSLVTRY*FDAHC 472 ++ DCV K SLV Y +C Sbjct: 272 ILCDCVVKEAQKSLVLTYEMRWYC 295 >AJ973445-1|CAJ01492.1| 127|Tribolium castaneum hypothetical protein protein. Length = 127 Score = 20.6 bits (41), Expect = 8.6 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = -3 Query: 463 IKLITSNKRMWW 428 I+ + NKR WW Sbjct: 88 IRYLIKNKRDWW 99 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,238 Number of Sequences: 336 Number of extensions: 2152 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -