BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30136 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0504 - 19771191-19772134,19772210-19774892 29 2.2 06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700,336... 28 3.9 05_04_0191 + 18927302-18927707,18928747-18928979,18929062-189291... 28 3.9 05_01_0460 - 3644229-3644420,3644623-3644865,3644959-3645237,364... 28 3.9 09_02_0060 + 3729613-3729863,3730377-3730392 28 5.1 03_02_0197 + 6337212-6337278,6339261-6340517,6340599-6340626,634... 27 6.8 >12_02_0504 - 19771191-19772134,19772210-19774892 Length = 1208 Score = 29.1 bits (62), Expect = 2.2 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 1/75 (1%) Frame = -2 Query: 323 YFLVKATIHHLNVVHFIFNFHVDKILRISFVWSR*NEAGGVGALDN-SYVVGV*EHXPGS 147 YF + L+ +H N + KIL+I + S E G+G +N + + V + G Sbjct: 652 YFNYIHKLQSLHCLHVPENIMLSKILQIGMLTSL-QELHGIGVAENDGHSMSVLSNLTGL 710 Query: 146 CRLWRSMLFCRNIQN 102 CRL S+ +N++N Sbjct: 711 CRL--SLRNLQNVRN 723 >06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700, 3363820-3364098,3364189-3364386,3364475-3365110, 3365209-3365463,3365579-3365685,3365770-3369566, 3369677-3370166,3370918-3371308,3371481-3371573, 3371687-3371810,3372544-3372791 Length = 2380 Score = 28.3 bits (60), Expect = 3.9 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 399 PNNEDRIAYLTGRCWPK 449 PNNE+ + Y +CWP+ Sbjct: 1134 PNNENMVGYNNKKCWPR 1150 >05_04_0191 + 18927302-18927707,18928747-18928979,18929062-18929127, 18929262-18929340,18929935-18930014,18930099-18930122, 18930254-18930375,18930902-18931109,18931960-18932006, 18932914-18932998,18933292-18933355,18933488-18933609 Length = 511 Score = 28.3 bits (60), Expect = 3.9 Identities = 8/19 (42%), Positives = 15/19 (78%) Frame = +3 Query: 312 DEKICYNYGIIKENEQFVM 368 DE +C+ YG ++ENE +++ Sbjct: 459 DEVLCWLYGTVRENEDYIL 477 >05_01_0460 - 3644229-3644420,3644623-3644865,3644959-3645237, 3645328-3645525,3645614-3646249,3646352-3646606, 3646718-3646824,3646909-3650705,3650816-3651305, 3652043-3652433,3652621-3652713,3652818-3652941, 3653871-3654118 Length = 2350 Score = 28.3 bits (60), Expect = 3.9 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 399 PNNEDRIAYLTGRCWPK 449 PNNE+ + Y +CWP+ Sbjct: 1134 PNNENMVGYNNKKCWPR 1150 >09_02_0060 + 3729613-3729863,3730377-3730392 Length = 88 Score = 27.9 bits (59), Expect = 5.1 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +2 Query: 173 LLHSYYPALRHRQLRSTCSIRSLSSIFCQ 259 L+H+ +P R+R R+TC R++ S+ C+ Sbjct: 32 LVHAKWPPSRYRSYRATC-CRAVPSLLCR 59 >03_02_0197 + 6337212-6337278,6339261-6340517,6340599-6340626, 6340735-6340897 Length = 504 Score = 27.5 bits (58), Expect = 6.8 Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = +2 Query: 8 GFLPKNLEFSIFYE-KMREEAIALFKLFYYAKDFECFYKTACYARVYMNQGNVLIRLLHS 184 G +P L++++F +EA+ L +Y F+ A +A Y+N NV + + + Sbjct: 210 GVIP--LDYALFRPLPPNKEAVDANTLLHYTNVFDAVVDAAYFAMAYLNVTNVPVMVTET 267 Query: 185 YYP 193 +P Sbjct: 268 GWP 270 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,365,942 Number of Sequences: 37544 Number of extensions: 246292 Number of successful extensions: 594 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 585 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 594 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -