BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30132 (516 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83233-11|CAB05757.2| 292|Caenorhabditis elegans Hypothetical p... 42 3e-04 U32305-18|AAK18852.2| 719|Caenorhabditis elegans Hypothetical p... 27 8.0 >Z83233-11|CAB05757.2| 292|Caenorhabditis elegans Hypothetical protein K06B4.9 protein. Length = 292 Score = 41.5 bits (93), Expect = 3e-04 Identities = 16/56 (28%), Positives = 28/56 (50%) Frame = +2 Query: 191 VTCVLMCLVVYRLDLCRSVTISY*VNSWAYRWENRDRCHHHLWMF*ILYNVDV*LV 358 +TC++ C V Y C + Y N W++ +EN D C +W L+N + ++ Sbjct: 129 ITCIIFCAVCYEFSKC---FLKYNPNHWSFEFENSDFCDSLIWYSDFLFNTGIDII 181 >U32305-18|AAK18852.2| 719|Caenorhabditis elegans Hypothetical protein B0336.3 protein. Length = 719 Score = 27.1 bits (57), Expect = 8.0 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -2 Query: 416 EIQLEPRFRSMTNKKKTSQKLIKHLHYIKFRTSKDDGD 303 E+ ++ R + KK + KL+KHLH K + K++ D Sbjct: 524 ELLIKARTSTDETDKKNATKLVKHLHK-KIKACKEEVD 560 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,764,468 Number of Sequences: 27780 Number of extensions: 171212 Number of successful extensions: 298 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 296 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 297 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -