BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30128 (401 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC090999-7|AAK26142.1| 438|Caenorhabditis elegans Hypothetical ... 29 1.2 U41021-9|AAQ81276.1| 408|Caenorhabditis elegans Temporarily ass... 28 2.2 U41021-8|AAQ81275.1| 406|Caenorhabditis elegans Temporarily ass... 28 2.2 Z93396-3|CAB07712.1| 597|Caenorhabditis elegans Hypothetical pr... 27 3.8 AF047652-2|AAC04393.3| 256|Caenorhabditis elegans Collagen prot... 27 6.7 AF047652-1|AAO44912.1| 294|Caenorhabditis elegans Collagen prot... 27 6.7 EF378622-1|ABN54457.1| 1492|Caenorhabditis elegans enhancer of g... 26 8.8 AL117201-3|CAL64007.1| 1512|Caenorhabditis elegans Hypothetical ... 26 8.8 >AC090999-7|AAK26142.1| 438|Caenorhabditis elegans Hypothetical protein Y82E9BR.12 protein. Length = 438 Score = 29.1 bits (62), Expect = 1.2 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +1 Query: 169 REAVMRFGLKGGAAVVTIIETLEFISQG 252 R AV++FG+ +V IIET+ F+S G Sbjct: 136 RTAVVKFGMHFDKVMVAIIETMVFLSLG 163 >U41021-9|AAQ81276.1| 408|Caenorhabditis elegans Temporarily assigned gene nameprotein 24, isoform b protein. Length = 408 Score = 28.3 bits (60), Expect = 2.2 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 391 IGRIGYRAPPRVFFFFFCL 335 IG G+ APP VF FFF L Sbjct: 348 IGAFGHEAPPLVFKFFFWL 366 >U41021-8|AAQ81275.1| 406|Caenorhabditis elegans Temporarily assigned gene nameprotein 24, isoform a protein. Length = 406 Score = 28.3 bits (60), Expect = 2.2 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 391 IGRIGYRAPPRVFFFFFCL 335 IG G+ APP VF FFF L Sbjct: 346 IGAFGHEAPPLVFKFFFWL 364 >Z93396-3|CAB07712.1| 597|Caenorhabditis elegans Hypothetical protein ZC15.5 protein. Length = 597 Score = 27.5 bits (58), Expect = 3.8 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -2 Query: 400 RLTIGRIGYRAPPRVFFFFFCLCEWTSSQPTW 305 R IG++GYR +F F+ + + S++P W Sbjct: 360 RRKIGKLGYRRKEELFLVFYMI--FNSNKPLW 389 >AF047652-2|AAC04393.3| 256|Caenorhabditis elegans Collagen protein 107, isoform a protein. Length = 256 Score = 26.6 bits (56), Expect = 6.7 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -2 Query: 187 NALLLHGRNRQGGGTYPCG 131 +A L+ GRN++ GGT CG Sbjct: 65 DASLIFGRNKRSGGTCGCG 83 >AF047652-1|AAO44912.1| 294|Caenorhabditis elegans Collagen protein 107, isoform b protein. Length = 294 Score = 26.6 bits (56), Expect = 6.7 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -2 Query: 187 NALLLHGRNRQGGGTYPCG 131 +A L+ GRN++ GGT CG Sbjct: 65 DASLIFGRNKRSGGTCGCG 83 >EF378622-1|ABN54457.1| 1492|Caenorhabditis elegans enhancer of glp-1 protein. Length = 1492 Score = 26.2 bits (55), Expect = 8.8 Identities = 10/31 (32%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = -3 Query: 90 FSRFFILTHWCID-INSRTKNAERHNLYIYH 1 + F+ + + D I+++ +NAE+ N +IYH Sbjct: 309 YPELFVTSSFLFDVISAKQRNAEKENDFIYH 339 >AL117201-3|CAL64007.1| 1512|Caenorhabditis elegans Hypothetical protein Y53H1C.2a protein. Length = 1512 Score = 26.2 bits (55), Expect = 8.8 Identities = 10/31 (32%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = -3 Query: 90 FSRFFILTHWCID-INSRTKNAERHNLYIYH 1 + F+ + + D I+++ +NAE+ N +IYH Sbjct: 329 YPELFVTSSFLFDVISAKQRNAEKENDFIYH 359 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,023,552 Number of Sequences: 27780 Number of extensions: 205970 Number of successful extensions: 372 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 371 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 372 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 630384202 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -