BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30128 (401 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g23640.1 68416.m02973 glycosyl hydrolase family 31 protein si... 27 4.7 At3g59060.2 68416.m06584 basic helix-loop-helix (bHLH) family pr... 27 6.2 At3g59060.1 68416.m06583 basic helix-loop-helix (bHLH) family pr... 27 6.2 At5g02630.1 68418.m00199 expressed protein 26 8.2 At3g12810.1 68416.m01598 SNF2 domain-containing protein / helica... 26 8.2 At1g30400.1 68414.m03716 glutathione S-conjugate ABC transporter... 26 8.2 >At3g23640.1 68416.m02973 glycosyl hydrolase family 31 protein similar to alpha-glucosidase II from SP:Q9F234 [Bacillus thermoamyloliquefaciens]; contains Pfam profile: PF01055 Glycosyl hydrolases family 31 Length = 991 Score = 27.1 bits (57), Expect = 4.7 Identities = 15/46 (32%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = -3 Query: 336 YVSGRV----HSPPGVKWLLEPIDIYNVNAPPTLRYKF*GLNYSYN 211 +V GR+ H P G++WL IDI Y+ G YN Sbjct: 773 WVGGRILSMTHVPSGIQWLHSRIDINGYEEYSGTEYRSAGCTEEYN 818 >At3g59060.2 68416.m06584 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 444 Score = 26.6 bits (56), Expect = 6.2 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 71 RMKNLEKRIYTFTGGRTSCESARVGTTTLPISAV 172 R KN+E+R+ T +GG + C R T+ ++V Sbjct: 176 RSKNVEERLDTSSGGSSGCSYGRNNKETVSGTSV 209 >At3g59060.1 68416.m06583 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 442 Score = 26.6 bits (56), Expect = 6.2 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 71 RMKNLEKRIYTFTGGRTSCESARVGTTTLPISAV 172 R KN+E+R+ T +GG + C R T+ ++V Sbjct: 176 RSKNVEERLDTSSGGSSGCSYGRNNKETVSGTSV 209 >At5g02630.1 68418.m00199 expressed protein Length = 428 Score = 26.2 bits (55), Expect = 8.2 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 13 QVVTLSILCSRIYIYTPVCKNE 78 ++ TLS C Y++ P+ KNE Sbjct: 391 EIATLSFYCLMFYMFRPIEKNE 412 >At3g12810.1 68416.m01598 SNF2 domain-containing protein / helicase domain-containing protein similar to transcriptional activator SRCAP [Homo sapiens] GI:5106572; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2055 Score = 26.2 bits (55), Expect = 8.2 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = +1 Query: 139 GRYHHPAYFC---REAVMRFGLKGGAAVV 216 GRY HPAY C RE + R L + V Sbjct: 1711 GRYRHPAYCCERYRELIQRHILSASDSAV 1739 >At1g30400.1 68414.m03716 glutathione S-conjugate ABC transporter (MRP1) identical to glutathione S-conjugate transporting ATPase (AtMRP1) [Arabidopsis thaliana] GI:2340166 Length = 1622 Score = 26.2 bits (55), Expect = 8.2 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = +1 Query: 154 PAYFCREAVMRFGLKGGAAVVTIIETLEFISQGGWRIYVVDVYGL 288 P Y V+ G A V+T++ET +I + W + +Y L Sbjct: 107 PPYEAFMLVLEAFAWGSALVMTVVETKTYIHELRWYVRFAVIYAL 151 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,374,527 Number of Sequences: 28952 Number of extensions: 193093 Number of successful extensions: 377 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 373 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 377 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 585758608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -