BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30120 (486 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT010014-1|AAQ22483.1| 1166|Drosophila melanogaster RE16941p pro... 28 7.8 AE014134-2470|AAN10874.1| 1166|Drosophila melanogaster CG32972-P... 28 7.8 AE014134-2469|AAS64704.1| 1853|Drosophila melanogaster CG32972-P... 28 7.8 >BT010014-1|AAQ22483.1| 1166|Drosophila melanogaster RE16941p protein. Length = 1166 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = -2 Query: 404 LRWSRKNVHDQKWNEFKNRC*PSEVTMSNDRDIALFRG 291 LR ++ N+HDQ+WN+ + + N +DI + +G Sbjct: 978 LRVNQYNMHDQEWNDVTLTTINGAMVVLNKKDIKIPQG 1015 >AE014134-2470|AAN10874.1| 1166|Drosophila melanogaster CG32972-PB, isoform B protein. Length = 1166 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = -2 Query: 404 LRWSRKNVHDQKWNEFKNRC*PSEVTMSNDRDIALFRG 291 LR ++ N+HDQ+WN+ + + N +DI + +G Sbjct: 978 LRVNQYNMHDQEWNDVTLTTINGAMVVLNKKDIKIPQG 1015 >AE014134-2469|AAS64704.1| 1853|Drosophila melanogaster CG32972-PA, isoform A protein. Length = 1853 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = -2 Query: 404 LRWSRKNVHDQKWNEFKNRC*PSEVTMSNDRDIALFRG 291 LR ++ N+HDQ+WN+ + + N +DI + +G Sbjct: 978 LRVNQYNMHDQEWNDVTLTTINGAMVVLNKKDIKIPQG 1015 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,094,502 Number of Sequences: 53049 Number of extensions: 349774 Number of successful extensions: 508 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 499 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 508 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1705394754 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -