BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30120 (486 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70035-11|CAA93872.1| 388|Caenorhabditis elegans Hypothetical p... 28 4.1 Z69383-10|CAM06587.1| 222|Caenorhabditis elegans Hypothetical p... 27 9.5 >Z70035-11|CAA93872.1| 388|Caenorhabditis elegans Hypothetical protein R09D1.13 protein. Length = 388 Score = 27.9 bits (59), Expect = 4.1 Identities = 11/34 (32%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -3 Query: 283 CVNTIHEIASYVANHLGHVTKVP-LTRYSLLRHV 185 CV+ +H A +AN + ++T +P + R+ LR++ Sbjct: 200 CVSDLHSFAFQIANGMEYLTHIPVIHRFLALRNI 233 >Z69383-10|CAM06587.1| 222|Caenorhabditis elegans Hypothetical protein F13E9.14 protein. Length = 222 Score = 26.6 bits (56), Expect = 9.5 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 105 VVVLINEQLQSI*SVTVYDRTILNSLETCLNNE 203 V + E Q++ SV ++LNSLET L NE Sbjct: 127 VTAKLEELKQNVTSVLTNLSSVLNSLETILENE 159 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,356,720 Number of Sequences: 27780 Number of extensions: 200607 Number of successful extensions: 345 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 336 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 345 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 903458030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -