BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30120 (486 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g19085.1 68416.m02424 hypothetical protein 28 3.8 At2g42400.1 68415.m05248 expressed protein 27 6.7 >At3g19085.1 68416.m02424 hypothetical protein Length = 228 Score = 27.9 bits (59), Expect = 3.8 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +1 Query: 253 NLRFHVLY*RTRNPRKRAMSRSLLIVTSLG*HLFLN 360 N FH+ Y +T PRKR + R LI S H+ ++ Sbjct: 89 NSDFHLKYGKTLGPRKRNVIRDFLIGISSVRHMIIS 124 >At2g42400.1 68415.m05248 expressed protein Length = 450 Score = 27.1 bits (57), Expect = 6.7 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +2 Query: 248 NITCDFMYCINALETHGKEQCHGHYSL*P 334 N +C F +N+ ETHG++ +G+ P Sbjct: 130 NFSCGFEDALNSTETHGQQLHYGYEGFDP 158 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,373,934 Number of Sequences: 28952 Number of extensions: 170646 Number of successful extensions: 240 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 236 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 240 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 838967680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -