BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30115 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC970.04c |mob2||protein kinase activator Mob2|Schizosaccharom... 26 2.9 SPAC29E6.02 |prp3|SPAC30.06|U4/U6 x U5 tri-snRNP complex subunit... 25 6.7 >SPCC970.04c |mob2||protein kinase activator Mob2|Schizosaccharomyces pombe|chr 3|||Manual Length = 244 Score = 26.2 bits (55), Expect = 2.9 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = +2 Query: 197 YTSLIKHPRFIHLDGWLQITVSE 265 +++++ PRF+ LD W+ + V E Sbjct: 70 FSTIVSLPRFVDLDEWVALNVYE 92 >SPAC29E6.02 |prp3|SPAC30.06|U4/U6 x U5 tri-snRNP complex subunit Prp3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 542 Score = 25.0 bits (52), Expect = 6.7 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 Query: 215 HPRFIHLDGWLQITVSESHKRRRHVSPSTRGHNLN 319 HP + LDG +Q T+ R+R S ST+G +L+ Sbjct: 107 HP--VLLDGNIQNTILTPENRKRTASFSTKGVSLS 139 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,690,430 Number of Sequences: 5004 Number of extensions: 26694 Number of successful extensions: 59 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 59 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 59 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -