BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30115 (516 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC110597-1|AAI10598.1| 411|Homo sapiens ligand-gated ion channe... 29 9.7 AK122638-1|BAC85499.1| 266|Homo sapiens yte protein of 76kDa) (... 29 9.7 AF512521-1|AAO20969.1| 411|Homo sapiens ligand-gated ion channe... 29 9.7 AB223030-1|BAE19924.1| 411|Homo sapiens ligand-gated ion-channe... 29 9.7 >BC110597-1|AAI10598.1| 411|Homo sapiens ligand-gated ion channel, zinc activated 1 protein. Length = 411 Score = 29.1 bits (62), Expect = 9.7 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -3 Query: 139 NGSAKALVNALKFVSN*FIIIIIYYPLRSM 50 NGSA LV+ FVSN F + I+ Y + SM Sbjct: 54 NGSAPLLVDVRVFVSNVFNVDILRYTMSSM 83 >AK122638-1|BAC85499.1| 266|Homo sapiens yte protein of 76kDa) (LCP2). protein. Length = 266 Score = 29.1 bits (62), Expect = 9.7 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -3 Query: 139 NGSAKALVNALKFVSN*FIIIIIYYPLRSM 50 NGSA LV+ FVSN F + I+ Y + SM Sbjct: 55 NGSAPLLVDVRVFVSNVFNVDILRYTMSSM 84 >AF512521-1|AAO20969.1| 411|Homo sapiens ligand-gated ion channel subunit protein. Length = 411 Score = 29.1 bits (62), Expect = 9.7 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -3 Query: 139 NGSAKALVNALKFVSN*FIIIIIYYPLRSM 50 NGSA LV+ FVSN F + I+ Y + SM Sbjct: 54 NGSAPLLVDVRVFVSNVFNVDILRYTMSSM 83 >AB223030-1|BAE19924.1| 411|Homo sapiens ligand-gated ion-channel receptor L2 protein. Length = 411 Score = 29.1 bits (62), Expect = 9.7 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -3 Query: 139 NGSAKALVNALKFVSN*FIIIIIYYPLRSM 50 NGSA LV+ FVSN F + I+ Y + SM Sbjct: 54 NGSAPLLVDVRVFVSNVFNVDILRYTMSSM 83 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 56,733,309 Number of Sequences: 237096 Number of extensions: 885914 Number of successful extensions: 1924 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1832 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1924 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4876707572 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -