BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30114 (516 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC012098-1|AAH12098.1| 702|Homo sapiens glucan (1,4-alpha-), br... 123 3e-28 AB209731-1|BAD92968.1| 754|Homo sapiens Glucan , branching enzy... 123 3e-28 L07956-1|AAA58642.1| 702|Homo sapiens 1,4-alpha-glucan branchin... 123 4e-28 Z97184-1|CAB09990.1| 634|Homo sapiens zinc finger protein 297 p... 30 5.5 BX248088-5|CAI41787.2| 634|Homo sapiens zinc finger and BTB dom... 30 5.5 BC018541-1|AAH18541.1| 634|Homo sapiens zinc finger and BTB dom... 30 5.5 AL662827-12|CAI17526.1| 634|Homo sapiens zinc finger and BTB do... 30 5.5 AL662820-12|CAI18123.1| 634|Homo sapiens zinc finger and BTB do... 30 5.5 X01179-1|CAA25619.1| 2351|Homo sapiens protein ( Human mRNA for ... 29 9.7 M88648-1|AAA52420.1| 2351|Homo sapiens coagulation factor VIII p... 29 9.7 M14113-1|AAA52485.1| 2351|Homo sapiens F8C protein. 29 9.7 K01740-1|AAA52484.1| 2351|Homo sapiens F8C protein. 29 9.7 BX890586-1|CAI43241.1| 2351|Homo sapiens coagulation factor VIII... 29 9.7 BX842564-3|CAI41666.1| 2351|Homo sapiens coagulation factor VIII... 29 9.7 BX842559-7|CAI41672.1| 2351|Homo sapiens coagulation factor VIII... 29 9.7 BX470111-13|CAI41660.1| 2351|Homo sapiens coagulation factor VII... 29 9.7 AY769950-1|AAV85964.1| 2351|Homo sapiens coagulation factor VIII... 29 9.7 >BC012098-1|AAH12098.1| 702|Homo sapiens glucan (1,4-alpha-), branching enzyme 1 (glycogen branching enzyme, Andersen di protein. Length = 702 Score = 123 bits (297), Expect = 3e-28 Identities = 56/143 (39%), Positives = 88/143 (61%), Gaps = 4/143 (2%) Frame = +1 Query: 100 SAMDPMEVPVPDLEKLLERDGYLKPYEREIRRRYACYKDIWDRIESWDGGLEAFTKGYKY 279 +A++ VP+L +LLE D YLKPY + +RRY + I I +GG++ F++GY+ Sbjct: 16 AALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIGENEGGIDKFSRGYES 75 Query: 280 YGPQFNQDGSVTWREWAPGAHSLHLRGEFNGWDSKSHPFAKKEYGKWEIQIPANPDGSCA 459 +G DG + +EWAPGA + L G+FNGW+ S+P+ K +YGKWE+ IP + S Sbjct: 76 FGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVL 135 Query: 460 LKHDSRVQIIVNDN----LYRIS 516 + H S++++++ LYRIS Sbjct: 136 VPHGSKLKVVITSKSGEILYRIS 158 >AB209731-1|BAD92968.1| 754|Homo sapiens Glucan , branching enzyme 1 variant protein. Length = 754 Score = 123 bits (297), Expect = 3e-28 Identities = 56/143 (39%), Positives = 88/143 (61%), Gaps = 4/143 (2%) Frame = +1 Query: 100 SAMDPMEVPVPDLEKLLERDGYLKPYEREIRRRYACYKDIWDRIESWDGGLEAFTKGYKY 279 +A++ VP+L +LLE D YLKPY + +RRY + I I +GG++ F++GY+ Sbjct: 68 AALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIGENEGGIDKFSRGYES 127 Query: 280 YGPQFNQDGSVTWREWAPGAHSLHLRGEFNGWDSKSHPFAKKEYGKWEIQIPANPDGSCA 459 +G DG + +EWAPGA + L G+FNGW+ S+P+ K +YGKWE+ IP + S Sbjct: 128 FGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVL 187 Query: 460 LKHDSRVQIIVNDN----LYRIS 516 + H S++++++ LYRIS Sbjct: 188 VPHGSKLKVVITSKSGEILYRIS 210 >L07956-1|AAA58642.1| 702|Homo sapiens 1,4-alpha-glucan branching enzyme protein. Length = 702 Score = 123 bits (296), Expect = 4e-28 Identities = 56/143 (39%), Positives = 88/143 (61%), Gaps = 4/143 (2%) Frame = +1 Query: 100 SAMDPMEVPVPDLEKLLERDGYLKPYEREIRRRYACYKDIWDRIESWDGGLEAFTKGYKY 279 +A++ VP+L +LLE D YLKPY + +RRY + I I +GG++ F++GY+ Sbjct: 16 AALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIGENEGGIDKFSRGYES 75 Query: 280 YGPQFNQDGSVTWREWAPGAHSLHLRGEFNGWDSKSHPFAKKEYGKWEIQIPANPDGSCA 459 +G DG + +EWAPGA + L G+FNGW+ S+P+ K +YGKWE+ IP + S Sbjct: 76 FGVHRCADGGLYSKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVL 135 Query: 460 LKHDSRVQIIVNDN----LYRIS 516 + H S++++++ LYRIS Sbjct: 136 VPHGSKLKVVITSKSGEILYRIS 158 >Z97184-1|CAB09990.1| 634|Homo sapiens zinc finger protein 297 protein. Length = 634 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -3 Query: 484 FGHGSRVSMHTN-HLDLRGFESPICRTPF 401 F H S H N HL+LR F+ P+C F Sbjct: 494 FSHKSMRDRHVNMHLNLRPFDCPVCNKKF 522 >BX248088-5|CAI41787.2| 634|Homo sapiens zinc finger and BTB domain containing 22 protein. Length = 634 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -3 Query: 484 FGHGSRVSMHTN-HLDLRGFESPICRTPF 401 F H S H N HL+LR F+ P+C F Sbjct: 494 FSHKSMRDRHVNMHLNLRPFDCPVCNKKF 522 >BC018541-1|AAH18541.1| 634|Homo sapiens zinc finger and BTB domain containing 22 protein. Length = 634 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -3 Query: 484 FGHGSRVSMHTN-HLDLRGFESPICRTPF 401 F H S H N HL+LR F+ P+C F Sbjct: 494 FSHKSMRDRHVNMHLNLRPFDCPVCNKKF 522 >AL662827-12|CAI17526.1| 634|Homo sapiens zinc finger and BTB domain containing 22 protein. Length = 634 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -3 Query: 484 FGHGSRVSMHTN-HLDLRGFESPICRTPF 401 F H S H N HL+LR F+ P+C F Sbjct: 494 FSHKSMRDRHVNMHLNLRPFDCPVCNKKF 522 >AL662820-12|CAI18123.1| 634|Homo sapiens zinc finger and BTB domain containing 22 protein. Length = 634 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -3 Query: 484 FGHGSRVSMHTN-HLDLRGFESPICRTPF 401 F H S H N HL+LR F+ P+C F Sbjct: 494 FSHKSMRDRHVNMHLNLRPFDCPVCNKKF 522 >X01179-1|CAA25619.1| 2351|Homo sapiens protein ( Human mRNA for factor VIII. ). Length = 2351 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 292 FNQDGSVTWREWAPGAHSLHLRGEFNGWDSKSHPFA 399 F S + +WAP LH G N W +K PF+ Sbjct: 2054 FQITASGQYGQWAPKLARLHYSGSINAWSTK-EPFS 2088 >M88648-1|AAA52420.1| 2351|Homo sapiens coagulation factor VIII protein. Length = 2351 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 292 FNQDGSVTWREWAPGAHSLHLRGEFNGWDSKSHPFA 399 F S + +WAP LH G N W +K PF+ Sbjct: 2054 FQITASGQYGQWAPKLARLHYSGSINAWSTK-EPFS 2088 >M14113-1|AAA52485.1| 2351|Homo sapiens F8C protein. Length = 2351 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 292 FNQDGSVTWREWAPGAHSLHLRGEFNGWDSKSHPFA 399 F S + +WAP LH G N W +K PF+ Sbjct: 2054 FQITASGQYGQWAPKLARLHYSGSINAWSTK-EPFS 2088 >K01740-1|AAA52484.1| 2351|Homo sapiens F8C protein. Length = 2351 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 292 FNQDGSVTWREWAPGAHSLHLRGEFNGWDSKSHPFA 399 F S + +WAP LH G N W +K PF+ Sbjct: 2054 FQITASGQYGQWAPKLARLHYSGSINAWSTK-EPFS 2088 >BX890586-1|CAI43241.1| 2351|Homo sapiens coagulation factor VIII, procoagulant component (hemophilia A) protein. Length = 2351 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 292 FNQDGSVTWREWAPGAHSLHLRGEFNGWDSKSHPFA 399 F S + +WAP LH G N W +K PF+ Sbjct: 2054 FQITASGQYGQWAPKLARLHYSGSINAWSTK-EPFS 2088 >BX842564-3|CAI41666.1| 2351|Homo sapiens coagulation factor VIII, procoagulant component (hemophilia A) protein. Length = 2351 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 292 FNQDGSVTWREWAPGAHSLHLRGEFNGWDSKSHPFA 399 F S + +WAP LH G N W +K PF+ Sbjct: 2054 FQITASGQYGQWAPKLARLHYSGSINAWSTK-EPFS 2088 >BX842559-7|CAI41672.1| 2351|Homo sapiens coagulation factor VIII, procoagulant component (hemophilia A) protein. Length = 2351 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 292 FNQDGSVTWREWAPGAHSLHLRGEFNGWDSKSHPFA 399 F S + +WAP LH G N W +K PF+ Sbjct: 2054 FQITASGQYGQWAPKLARLHYSGSINAWSTK-EPFS 2088 >BX470111-13|CAI41660.1| 2351|Homo sapiens coagulation factor VIII, procoagulant component (hemophilia A) protein. Length = 2351 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 292 FNQDGSVTWREWAPGAHSLHLRGEFNGWDSKSHPFA 399 F S + +WAP LH G N W +K PF+ Sbjct: 2054 FQITASGQYGQWAPKLARLHYSGSINAWSTK-EPFS 2088 >AY769950-1|AAV85964.1| 2351|Homo sapiens coagulation factor VIII, procoagulant component (hemophilia A) protein. Length = 2351 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 292 FNQDGSVTWREWAPGAHSLHLRGEFNGWDSKSHPFA 399 F S + +WAP LH G N W +K PF+ Sbjct: 2054 FQITASGQYGQWAPKLARLHYSGSINAWSTK-EPFS 2088 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,932,575 Number of Sequences: 237096 Number of extensions: 1975371 Number of successful extensions: 3218 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 3099 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3218 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4876707572 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -