BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30111 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1247 + 35233756-35233785,35234902-35236107 29 2.9 11_02_0111 + 8396304-8396378,8396697-8397113,8397220-8397483,839... 27 6.8 >02_05_1247 + 35233756-35233785,35234902-35236107 Length = 411 Score = 28.7 bits (61), Expect = 2.9 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 40 HAGLSKGETEVSTRRAHATLPLRRS 114 H +SKG+ ++ RR LPLRRS Sbjct: 346 HVSISKGDECIAVRRDRNVLPLRRS 370 >11_02_0111 + 8396304-8396378,8396697-8397113,8397220-8397483, 8398237-8398608 Length = 375 Score = 27.5 bits (58), Expect = 6.8 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = +2 Query: 2 SDGVTRTFPLSRYTPVSPREKLKSLLAEHMPRSLYEGLYTD*KIFCSNF 148 ++G++ T S R ++SL+A H + E L+T +F NF Sbjct: 306 AEGISATHTAGESMSASLRAAMESLIASHFGEGILEELFT---VFARNF 351 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,400,448 Number of Sequences: 37544 Number of extensions: 195326 Number of successful extensions: 375 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 374 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 375 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -