BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30111 (516 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY058459-1|AAL13688.1| 388|Drosophila melanogaster GH26015p pro... 58 9e-09 AE013599-1392|AAF58586.1| 388|Drosophila melanogaster CG8888-PA... 58 9e-09 >AY058459-1|AAL13688.1| 388|Drosophila melanogaster GH26015p protein. Length = 388 Score = 57.6 bits (133), Expect = 9e-09 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = +2 Query: 5 DGVTRTFPLSRYTPVSPREKLKSLLAEHMPRSLYEGLYTD*KIF 136 D VTRTFP++RYTPV+ E+L+ LAEH+ SLYE LY + K F Sbjct: 343 DAVTRTFPMARYTPVTSSERLQIFLAEHLAPSLYESLYGEQKKF 386 >AE013599-1392|AAF58586.1| 388|Drosophila melanogaster CG8888-PA protein. Length = 388 Score = 57.6 bits (133), Expect = 9e-09 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = +2 Query: 5 DGVTRTFPLSRYTPVSPREKLKSLLAEHMPRSLYEGLYTD*KIF 136 D VTRTFP++RYTPV+ E+L+ LAEH+ SLYE LY + K F Sbjct: 343 DAVTRTFPMARYTPVTSSERLQIFLAEHLAPSLYESLYGEQKKF 386 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,011,591 Number of Sequences: 53049 Number of extensions: 367639 Number of successful extensions: 654 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 645 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1887744768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -