BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30106 (322 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59269| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.5 SB_32728| Best HMM Match : Astacin (HMM E-Value=0) 28 1.9 SB_10520| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.9 SB_20038| Best HMM Match : wnt (HMM E-Value=3.8e-05) 27 4.5 SB_19563| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.5 SB_35017| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.9 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.9 SB_6819| Best HMM Match : zf-CCHC (HMM E-Value=0.46) 26 5.9 SB_6004| Best HMM Match : zf-B_box (HMM E-Value=4.5) 26 7.9 SB_54| Best HMM Match : Actin (HMM E-Value=0) 26 7.9 >SB_59269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1008 Score = 28.3 bits (60), Expect = 1.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -3 Query: 179 HCLHMFKPYLRIKPCLLEQDRHD 111 H LH P KPCLL+ D H+ Sbjct: 318 HGLHFGSPARARKPCLLDHDEHE 340 >SB_32728| Best HMM Match : Astacin (HMM E-Value=0) Length = 321 Score = 27.9 bits (59), Expect = 1.9 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 62 TQIFGILTLADTDKDPGHADPAPTGMA*SASTV 160 + IF LTL +TD D H+D P G A A + Sbjct: 22 SDIFDDLTLEETDLDLPHSDLPPEGFAGDAREI 54 >SB_10520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1280 Score = 27.9 bits (59), Expect = 1.9 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = +2 Query: 89 ADTDKDPGHADPAPTGMA*SASTV*TYADSASESMLMT*DSRSWTKWSRNNK 244 +D ++ G AD PT +A ++ T++ SA+ + D W+ WS NK Sbjct: 373 SDANQSSGSADIHPTPVA----SIITWSSSANSRFPVDGDWTEWSTWSYCNK 420 >SB_20038| Best HMM Match : wnt (HMM E-Value=3.8e-05) Length = 155 Score = 26.6 bits (56), Expect = 4.5 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 118 GMTGILVRICEGENTKYLR 62 G TG+L R+C +N YL+ Sbjct: 88 GSTGVLGRVCSSDNPDYLK 106 >SB_19563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 26.6 bits (56), Expect = 4.5 Identities = 11/42 (26%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -1 Query: 199 HEHTL*STVCICSNRTCGLSHACWSRI--GMTGILVRICEGE 80 H H ++ + SN T G + +CW+ + G+ + V++ E Sbjct: 32 HRHVRKESLWVLSNLTAGPAESCWAVVHAGLVPVTVKMLASE 73 >SB_35017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 26.2 bits (55), Expect = 5.9 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +1 Query: 97 GQGSRSCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 222 G+ +R +C + ++ G N+CR C + +D + +D Sbjct: 59 GESARF-EACCDGQDMVNDNGANVCRNCGVHHGYDYAVEYVD 99 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 26.2 bits (55), Expect = 5.9 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +1 Query: 94 YGQGSRSC--RSCSNRHGLIRKYGLNICRQCFREYAHD 201 Y +GS C +SC + +YG N C C Y+ D Sbjct: 144 YDRGSVQCSVKSCLLANRRPCEYGQNFCGPCLNGYSQD 181 >SB_6819| Best HMM Match : zf-CCHC (HMM E-Value=0.46) Length = 335 Score = 26.2 bits (55), Expect = 5.9 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = +1 Query: 79 SHPRRYGQGSRSCRSCSNRH--GLIRKYGLNICRQC 180 + P R+ + SCR C +H G Y ICR+C Sbjct: 275 ARPSRFDRNQNSCRFCGLQHDRGNCPAYNA-ICRRC 309 >SB_6004| Best HMM Match : zf-B_box (HMM E-Value=4.5) Length = 279 Score = 25.8 bits (54), Expect = 7.9 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 106 SRSCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKL 219 ++ C++C H L RK+G+ +Q E I K+L Sbjct: 230 NKHCKNCRKIHELARKHGIFQIKQLINEQRIWISEKEL 267 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 25.8 bits (54), Expect = 7.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 90 QIRTRIPVMPILLQQAWLNPQVRFEHM 170 Q+R R P+LL +A LNP++ E M Sbjct: 2138 QLRVRGEDFPVLLTEAPLNPKMNRERM 2164 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,232,976 Number of Sequences: 59808 Number of extensions: 203306 Number of successful extensions: 474 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 474 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 425519554 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -