BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30106 (322 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY075533-1|AAL68340.2| 68|Drosophila melanogaster RH06643p pro... 120 6e-28 AE014297-1040|AAF54450.1| 56|Drosophila melanogaster CG8495-PA... 120 6e-28 BT001305-1|AAN71060.1| 43|Drosophila melanogaster AT13329p pro... 79 1e-15 AE014297-1041|AAN13446.1| 55|Drosophila melanogaster CG8495-PC... 79 1e-15 AY060673-1|AAL28221.3| 446|Drosophila melanogaster GH10523p pro... 28 2.3 AE014297-1276|AAF54621.2| 446|Drosophila melanogaster CG31388-P... 28 2.3 BT025854-1|ABF85754.1| 1031|Drosophila melanogaster IP15264p pro... 27 5.4 AF145617-1|AAD38592.1| 594|Drosophila melanogaster BcDNA.GH0352... 27 5.4 AE014296-337|AAF47553.2| 881|Drosophila melanogaster CG2086-PB,... 27 5.4 AE014296-336|AAF47552.1| 594|Drosophila melanogaster CG2086-PA,... 27 5.4 AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-P... 27 5.4 AE013599-629|AAF59106.1| 284|Drosophila melanogaster CG14755-PA... 27 5.4 BT003320-1|AAO25080.1| 798|Drosophila melanogaster AT11823p pro... 27 7.1 AY069327-1|AAL39472.2| 552|Drosophila melanogaster LD04591p pro... 27 7.1 AE014297-4076|AAF56673.2| 980|Drosophila melanogaster CG6051-PA... 27 7.1 AY094796-1|AAM11149.1| 396|Drosophila melanogaster LD22815p pro... 26 9.4 AE013599-2215|AAF58045.2| 396|Drosophila melanogaster CG8446-PA... 26 9.4 >AY075533-1|AAL68340.2| 68|Drosophila melanogaster RH06643p protein. Length = 68 Score = 120 bits (288), Expect = 6e-28 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = +1 Query: 55 MGHANIWYSHPRRYGQGSRSCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 222 MG A +WYSHPR+YGQGSR CR+CSNRHGLIRKYGLNICRQCFREYA+DIGFKKLD Sbjct: 13 MGFATLWYSHPRKYGQGSRCCRACSNRHGLIRKYGLNICRQCFREYANDIGFKKLD 68 >AE014297-1040|AAF54450.1| 56|Drosophila melanogaster CG8495-PA, isoform A protein. Length = 56 Score = 120 bits (288), Expect = 6e-28 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = +1 Query: 55 MGHANIWYSHPRRYGQGSRSCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 222 MG A +WYSHPR+YGQGSR CR+CSNRHGLIRKYGLNICRQCFREYA+DIGFKKLD Sbjct: 1 MGFATLWYSHPRKYGQGSRCCRACSNRHGLIRKYGLNICRQCFREYANDIGFKKLD 56 >BT001305-1|AAN71060.1| 43|Drosophila melanogaster AT13329p protein. Length = 43 Score = 79.4 bits (187), Expect = 1e-15 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 118 RSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 222 R+CSNRHGLIRKYGLNICRQCFREYA+DIGFKKLD Sbjct: 9 RACSNRHGLIRKYGLNICRQCFREYANDIGFKKLD 43 >AE014297-1041|AAN13446.1| 55|Drosophila melanogaster CG8495-PC, isoform C protein. Length = 55 Score = 79.4 bits (187), Expect = 1e-15 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 118 RSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 222 R+CSNRHGLIRKYGLNICRQCFREYA+DIGFKKLD Sbjct: 21 RACSNRHGLIRKYGLNICRQCFREYANDIGFKKLD 55 >AY060673-1|AAL28221.3| 446|Drosophila melanogaster GH10523p protein. Length = 446 Score = 28.3 bits (60), Expect = 2.3 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +1 Query: 85 PRRYGQGSRSCRSCSNRHGLIRKYGLNICRQCFREYAH 198 P+ Y S CR+ H L R +G ICR F+ H Sbjct: 377 PKSYVTPSE-CRTHQKYHNLTRDHGCEICRISFKTAKH 413 >AE014297-1276|AAF54621.2| 446|Drosophila melanogaster CG31388-PA protein. Length = 446 Score = 28.3 bits (60), Expect = 2.3 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +1 Query: 85 PRRYGQGSRSCRSCSNRHGLIRKYGLNICRQCFREYAH 198 P+ Y S CR+ H L R +G ICR F+ H Sbjct: 377 PKSYVTPSE-CRTHQKYHNLTRDHGCEICRISFKTAKH 413 >BT025854-1|ABF85754.1| 1031|Drosophila melanogaster IP15264p protein. Length = 1031 Score = 27.1 bits (57), Expect = 5.4 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -1 Query: 196 EHTL*STVCICSNRTCGLSHACWSRIGMTG 107 EH + + C +N C +H C R G TG Sbjct: 748 EHCMNTCACPSANFQCHAAHGCVCRSGYTG 777 >AF145617-1|AAD38592.1| 594|Drosophila melanogaster BcDNA.GH03529 protein. Length = 594 Score = 27.1 bits (57), Expect = 5.4 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -1 Query: 196 EHTL*STVCICSNRTCGLSHACWSRIGMTG 107 EH + + C +N C +H C R G TG Sbjct: 300 EHCMNTCACPSANFQCHAAHGCVCRSGYTG 329 >AE014296-337|AAF47553.2| 881|Drosophila melanogaster CG2086-PB, isoform B protein. Length = 881 Score = 27.1 bits (57), Expect = 5.4 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -1 Query: 196 EHTL*STVCICSNRTCGLSHACWSRIGMTG 107 EH + + C +N C +H C R G TG Sbjct: 587 EHCMNTCACPSANFQCHAAHGCVCRSGYTG 616 >AE014296-336|AAF47552.1| 594|Drosophila melanogaster CG2086-PA, isoform A protein. Length = 594 Score = 27.1 bits (57), Expect = 5.4 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -1 Query: 196 EHTL*STVCICSNRTCGLSHACWSRIGMTG 107 EH + + C +N C +H C R G TG Sbjct: 300 EHCMNTCACPSANFQCHAAHGCVCRSGYTG 329 >AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-PB protein. Length = 23015 Score = 27.1 bits (57), Expect = 5.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 166 CSNRTCGLSHACWSRIG 116 C+N+ CGL+ AC +R G Sbjct: 1437 CANKPCGLNAACLNRAG 1453 >AE013599-629|AAF59106.1| 284|Drosophila melanogaster CG14755-PA protein. Length = 284 Score = 27.1 bits (57), Expect = 5.4 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -2 Query: 90 ARVRIPNICVAHFKKLNCFSLTSNKLDT 7 +R + N+C+ HF+ NC NK ++ Sbjct: 254 SRTALLNLCITHFRLSNCSDSGQNKSES 281 >BT003320-1|AAO25080.1| 798|Drosophila melanogaster AT11823p protein. Length = 798 Score = 26.6 bits (56), Expect = 7.1 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 5/40 (12%) Frame = +1 Query: 103 GSRSCRSCSNRHGLIRKYGL----NICRQCF-REYAHDIG 207 G C CSN + KYGL +CR C+ RE +G Sbjct: 744 GGVFCGVCSNASAPLPKYGLTKAVRVCRDCYVREVRSGMG 783 >AY069327-1|AAL39472.2| 552|Drosophila melanogaster LD04591p protein. Length = 552 Score = 26.6 bits (56), Expect = 7.1 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 5/40 (12%) Frame = +1 Query: 103 GSRSCRSCSNRHGLIRKYGL----NICRQCF-REYAHDIG 207 G C CSN + KYGL +CR C+ RE +G Sbjct: 498 GGVFCGVCSNASAPLPKYGLTKAVRVCRDCYVREVRSGMG 537 >AE014297-4076|AAF56673.2| 980|Drosophila melanogaster CG6051-PA protein. Length = 980 Score = 26.6 bits (56), Expect = 7.1 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 5/40 (12%) Frame = +1 Query: 103 GSRSCRSCSNRHGLIRKYGL----NICRQCF-REYAHDIG 207 G C CSN + KYGL +CR C+ RE +G Sbjct: 926 GGVFCGVCSNASAPLPKYGLTKAVRVCRDCYVREVRSGMG 965 >AY094796-1|AAM11149.1| 396|Drosophila melanogaster LD22815p protein. Length = 396 Score = 26.2 bits (55), Expect = 9.4 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +1 Query: 103 GSRSCRSCSNRHGLIRKYGLNI-CRQCFREYA 195 G+ +C S R RKY LNI R FRE+A Sbjct: 138 GNLNCTFFSPRERYDRKYNLNIVTRALFREWA 169 >AE013599-2215|AAF58045.2| 396|Drosophila melanogaster CG8446-PA protein. Length = 396 Score = 26.2 bits (55), Expect = 9.4 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +1 Query: 103 GSRSCRSCSNRHGLIRKYGLNI-CRQCFREYA 195 G+ +C S R RKY LNI R FRE+A Sbjct: 138 GNLNCTFFSPRERYDRKYNLNIVTRALFREWA 169 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,959,512 Number of Sequences: 53049 Number of extensions: 293410 Number of successful extensions: 670 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 670 length of database: 24,988,368 effective HSP length: 74 effective length of database: 21,062,742 effective search space used: 674007744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -