BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30106 (322 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U80953-1|AAB52557.2| 56|Caenorhabditis elegans Ribosomal prote... 101 9e-23 Z72504-3|CAA96605.1| 449|Caenorhabditis elegans Hypothetical pr... 31 0.18 AF273784-1|AAG15133.1| 459|Caenorhabditis elegans nuclear recep... 31 0.18 U53341-1|AAC69110.3| 727|Caenorhabditis elegans Hypothetical pr... 30 0.32 Z74040-6|CAA98509.2| 457|Caenorhabditis elegans Hypothetical pr... 29 0.56 AF022985-15|AAB69969.2| 435|Caenorhabditis elegans Hypothetical... 28 1.3 AF100669-3|AAK39266.1| 747|Caenorhabditis elegans Hypothetical ... 27 4.0 Z81505-1|CAB04122.1| 673|Caenorhabditis elegans Hypothetical pr... 26 5.3 >U80953-1|AAB52557.2| 56|Caenorhabditis elegans Ribosomal protein, small subunitprotein 29 protein. Length = 56 Score = 101 bits (243), Expect = 9e-23 Identities = 40/56 (71%), Positives = 48/56 (85%) Frame = +1 Query: 55 MGHANIWYSHPRRYGQGSRSCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 222 MG N+W+SHPR++G GSRSCR C+ HGLIRKYGL++CR+CFRE A DIGFKKLD Sbjct: 1 MGFQNLWFSHPRKFGPGSRSCRVCAGHHGLIRKYGLDLCRRCFREQARDIGFKKLD 56 >Z72504-3|CAA96605.1| 449|Caenorhabditis elegans Hypothetical protein C29E6.5 protein. Length = 449 Score = 31.1 bits (67), Expect = 0.18 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 115 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 216 CR C R+ + +G++ICR C + + KK Sbjct: 47 CRVCERRYDGSQHFGIDICRACAAFFRRSVAVKK 80 >AF273784-1|AAG15133.1| 459|Caenorhabditis elegans nuclear receptor NHR-43 protein. Length = 459 Score = 31.1 bits (67), Expect = 0.18 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 115 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 216 CR C R+ + +G++ICR C + + KK Sbjct: 57 CRVCERRYDGSQHFGIDICRACAAFFRRSVAVKK 90 >U53341-1|AAC69110.3| 727|Caenorhabditis elegans Hypothetical protein F49E10.5 protein. Length = 727 Score = 30.3 bits (65), Expect = 0.32 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +3 Query: 102 RIPVMPILLQQAWLNPQVRFEHMQTVLQRVCS*H 203 RIP P++L+Q WL R E R+CS H Sbjct: 27 RIPKRPLILRQRWLTAIGRTEETVVSQLRICSAH 60 >Z74040-6|CAA98509.2| 457|Caenorhabditis elegans Hypothetical protein K10D6.1 protein. Length = 457 Score = 29.5 bits (63), Expect = 0.56 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +3 Query: 114 MPILLQQAWLNPQVRFEHMQTVLQRVCS*HRIQE 215 M I + + WL+P ++F+H+ Q + H++ E Sbjct: 101 MDIYINEMWLDPALKFDHLNPCKQNLSVSHQVLE 134 >AF022985-15|AAB69969.2| 435|Caenorhabditis elegans Hypothetical protein T15B7.16 protein. Length = 435 Score = 28.3 bits (60), Expect = 1.3 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +3 Query: 114 MPILLQQAWLNPQVRFEHMQTVLQRV 191 + +L Q W +P++RF+H+ LQ + Sbjct: 80 LDLLFSQIWHDPRLRFDHLTNCLQNL 105 >AF100669-3|AAK39266.1| 747|Caenorhabditis elegans Hypothetical protein R11E3.4 protein. Length = 747 Score = 26.6 bits (56), Expect = 4.0 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +1 Query: 49 LKMGHANIWYSHPRRYGQGSR-SCRSCSNRHGLIRKY 156 LK A W+ +P+R G +R C SC ++R + Sbjct: 482 LKKQLARPWFVNPKRIGNVARICCHSCQPNMAMVRVF 518 >Z81505-1|CAB04122.1| 673|Caenorhabditis elegans Hypothetical protein F16A11.1 protein. Length = 673 Score = 26.2 bits (55), Expect = 5.3 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -1 Query: 139 HACWSRIGMTGILVRICEGENTKYLRG-PF*EIKL-FLANEQ 20 H W + G+L+ I EGE YL G P E + FL+N Q Sbjct: 453 HENWQPGDVIGVLLNIPEGEVVFYLNGTPLKEPETEFLSNRQ 494 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,399,771 Number of Sequences: 27780 Number of extensions: 139978 Number of successful extensions: 337 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 332 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 337 length of database: 12,740,198 effective HSP length: 71 effective length of database: 10,767,818 effective search space used: 376873630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -