BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30103 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0575 + 18885403-18885483,18885591-18885949,18886320-18886617 27 6.8 12_01_0213 - 1614964-1615022,1615329-1615521 27 8.9 >10_08_0575 + 18885403-18885483,18885591-18885949,18886320-18886617 Length = 245 Score = 27.5 bits (58), Expect = 6.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 425 RQRDSHWVTNSNWMI 381 R RD HW+T WMI Sbjct: 135 RTRDVHWMTQGTWMI 149 >12_01_0213 - 1614964-1615022,1615329-1615521 Length = 83 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 373 YAGIIQLLLVTQCESLCLSFKRKLDLQMSYCR 468 Y + + +VT C LC S+ R + L M+Y R Sbjct: 51 YGSFLFVWIVTLCTDLCTSYNRSI-LAMAYSR 81 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,458,177 Number of Sequences: 37544 Number of extensions: 200689 Number of successful extensions: 295 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 291 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 295 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -