BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30103 (516 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X62420-1|CAA44286.1| 2515|Drosophila melanogaster tudor protein ... 31 0.93 AE013599-3155|AAF46693.1| 2515|Drosophila melanogaster CG9450-PA... 31 0.93 >X62420-1|CAA44286.1| 2515|Drosophila melanogaster tudor protein protein. Length = 2515 Score = 31.1 bits (67), Expect = 0.93 Identities = 24/65 (36%), Positives = 38/65 (58%), Gaps = 5/65 (7%) Frame = +3 Query: 318 LKHKHRYENYNVNLSYIPVRWYHPITVGHPM-RIPLSKFQE---KVGLA-DVILS*CLQP 482 ++H ++ N NV+LSY+P R+ P T +IP+ F+ VGL DV++S ++ Sbjct: 364 IQHFNQQAN-NVSLSYVPARFTPPPTPSIAQHQIPIPAFRTTSLTVGLTYDVVIS-YVEN 421 Query: 483 GKYLF 497 G YLF Sbjct: 422 GPYLF 426 >AE013599-3155|AAF46693.1| 2515|Drosophila melanogaster CG9450-PA protein. Length = 2515 Score = 31.1 bits (67), Expect = 0.93 Identities = 24/65 (36%), Positives = 38/65 (58%), Gaps = 5/65 (7%) Frame = +3 Query: 318 LKHKHRYENYNVNLSYIPVRWYHPITVGHPM-RIPLSKFQE---KVGLA-DVILS*CLQP 482 ++H ++ N NV+LSY+P R+ P T +IP+ F+ VGL DV++S ++ Sbjct: 364 IQHFNQQAN-NVSLSYVPARFTPPPTPSIAQHQIPIPAFRTTSLTVGLTYDVVIS-YVEN 421 Query: 483 GKYLF 497 G YLF Sbjct: 422 GPYLF 426 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,300,454 Number of Sequences: 53049 Number of extensions: 380861 Number of successful extensions: 735 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 735 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1887744768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -