BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30102 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox prote... 26 0.66 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 25 1.5 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 25 1.5 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 23 4.6 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 23 6.1 >AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox protein protein. Length = 338 Score = 26.2 bits (55), Expect = 0.66 Identities = 14/67 (20%), Positives = 32/67 (47%) Frame = +3 Query: 111 FRRLSSVSSTPGTPTLY*TPQAIRTV*HGTSISGSARGPARTKPARRPSSR*TWTTNNSR 290 +R+L TP Y + + ++ G++++ +A G + + P PS+ + T + Sbjct: 125 YRKLYRGEKTPERYAPYLAVRPVESLTSGSNVAAAAAGASASTPPTIPSASPSPTRSTDL 184 Query: 291 DQRYSTE 311 Q Y+ + Sbjct: 185 SQTYAID 191 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 25.0 bits (52), Expect = 1.5 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +3 Query: 276 TNNSRDQRYSTERSNITSPRSS*NISHQPSAI*KADTPQA 395 T + D+ S R+N T S ++S S +A+TP+A Sbjct: 259 TEDDEDENISVTRTNSTIRSRSSSLSRSRSCSRQAETPRA 298 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 25.0 bits (52), Expect = 1.5 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +2 Query: 275 DEQFQGSAVQHREVQYYXS-KEFLEYFSPAIRYLKG 379 DE A++ E + S KE+L Y SP+ +L G Sbjct: 958 DESDDNGAIKQNEFPSWASNKEYLAYNSPSATFLGG 993 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -3 Query: 169 GVQYNVGVPGVEETELSLRNGDRFEV 92 G N +PGVEE L N + EV Sbjct: 1296 GFGNNDNLPGVEEVAAELENANESEV 1321 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 23.0 bits (47), Expect = 6.1 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 271 GRRTIPGISGTAPRGPILXVQGVP 342 G+ +PG+SG A + +QG+P Sbjct: 491 GKVGVPGLSGEAGAKGEMGIQGLP 514 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 521,033 Number of Sequences: 2352 Number of extensions: 10399 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -