BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30101 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0491 + 4093952-4094145,4094336-4094642,4094700-4094799,409... 27 6.8 >05_01_0491 + 4093952-4094145,4094336-4094642,4094700-4094799, 4094823-4094953,4095546-4095823,4095909-4096225, 4096322-4096506 Length = 503 Score = 27.5 bits (58), Expect = 6.8 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = -2 Query: 143 IFQTMLKEETLNILNKINSKISFYFIQSHT*THVIWFTLNYYYRY 9 I ++ K + NI K++ FYFI+ T + L YY Y Sbjct: 202 ILVSLRKVDLFNIFKKVHGGAKFYFIKLGTKILISSVKLRYYESY 246 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,208,427 Number of Sequences: 37544 Number of extensions: 138315 Number of successful extensions: 284 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 283 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 284 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -