BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30101 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted ... 25 2.0 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 6.1 >DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted polypeptide protein. Length = 125 Score = 24.6 bits (51), Expect = 2.0 Identities = 11/30 (36%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = -2 Query: 404 KVRKCASTC---KCYEYLLACADVVFLKCY 324 +V KC C CY +L CA + +CY Sbjct: 59 EVFKCCGPCYQLNCYGTVLDCAGRCYAECY 88 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 6.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 173 LNEH*KYSLYIFQTMLKEETLNILNKINS 87 L E+ S+YI +T LK L L ++NS Sbjct: 396 LKENLFASVYIVKTSLKSLELKSLKRVNS 424 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 434,594 Number of Sequences: 2352 Number of extensions: 8922 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -