BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30101 (516 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z67755-9|CAM33504.2| 224|Caenorhabditis elegans Hypothetical pr... 30 1.1 Z98851-3|CAB11538.2| 659|Caenorhabditis elegans Hypothetical pr... 29 1.5 Z81485-4|CAB03978.1| 343|Caenorhabditis elegans Hypothetical pr... 29 2.0 Z81111-4|CAB03264.1| 415|Caenorhabditis elegans Hypothetical pr... 27 6.0 AC006679-2|AAK84465.2| 425|Caenorhabditis elegans Ligand-gated ... 27 8.0 >Z67755-9|CAM33504.2| 224|Caenorhabditis elegans Hypothetical protein F54F7.9 protein. Length = 224 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +1 Query: 88 ELILFKIFSVSSFNIV*KIYKEYFQC-SFKVSKATLNCPLCYQ 213 E+ + K F + F I K+Y+E F+C + + S T N CY+ Sbjct: 96 EVKVLKYFHDAVFYIGNKVYREGFECMTLEFSSITTNAQKCYE 138 >Z98851-3|CAB11538.2| 659|Caenorhabditis elegans Hypothetical protein H12I19.4 protein. Length = 659 Score = 29.5 bits (63), Expect = 1.5 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -2 Query: 158 KYSLYIFQTMLKEETLNILNKINSKISFY 72 +YS Y+ +L EET L K+N+ I+FY Sbjct: 508 RYSDYVKGPILNEETDRTLEKMNNNIAFY 536 >Z81485-4|CAB03978.1| 343|Caenorhabditis elegans Hypothetical protein C49F5.4 protein. Length = 343 Score = 29.1 bits (62), Expect = 2.0 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = -2 Query: 410 SVKVRKCASTCKCYE---YLLACADVVFLKCYFILCVLTIYVL 291 +V ++KC +C+E Y+ C F KC ++ L Y+L Sbjct: 39 TVPIKKCFRGERCFEKTPYIFKCTSCRFQKCLYVGMTLPSYLL 81 >Z81111-4|CAB03264.1| 415|Caenorhabditis elegans Hypothetical protein T01G5.4 protein. Length = 415 Score = 27.5 bits (58), Expect = 6.0 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = +1 Query: 76 NEILELILFKIFSVSSFNIV*KIYKEY 156 NEILELILF S+SSF V ++ Y Sbjct: 261 NEILELILFANQSLSSFGSVTPLFLFY 287 >AC006679-2|AAK84465.2| 425|Caenorhabditis elegans Ligand-gated ion channel protein 12 protein. Length = 425 Score = 27.1 bits (57), Expect = 8.0 Identities = 8/27 (29%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = -2 Query: 371 YEYLLACADVVFLKCYFIL-CVLTIYV 294 ++ +CAD++ C+F + C++T Y+ Sbjct: 394 WQRFFSCADIICGSCFFFVNCIITFYM 420 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,461,387 Number of Sequences: 27780 Number of extensions: 170144 Number of successful extensions: 373 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 356 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 373 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -