BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30092 (828 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 6.8 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 22 6.8 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.8 bits (44), Expect = 6.8 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = +1 Query: 508 HNYAAKS*MTLLPALVMLVSRSVTLLHEHFLLLS*IHGDV 627 HN + ++ + P ++ ++R V L EH +H D+ Sbjct: 579 HNMSFENDFIIQPKHLLSIARQVALGMEHLAKTRVVHRDL 618 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 21.8 bits (44), Expect = 6.8 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = -3 Query: 562 PTLPELAVRSFMTWLHSYVNLFSEPCKRCSCHLHHTS 452 PT+P++ F T S +P R SC +TS Sbjct: 209 PTVPKIPPAEFPTTSSSSALESPDPASRSSCLGSNTS 245 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,082 Number of Sequences: 336 Number of extensions: 4359 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22725411 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -