Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV30092
         (828 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667193-1|ABG75745.1|  510|Apis mellifera cys-loop ligand-gated...    23   4.6  
DQ244075-1|ABB36785.1|  548|Apis mellifera cytochrome P450 monoo...    22   8.0  

>DQ667193-1|ABG75745.1|  510|Apis mellifera cys-loop ligand-gated
           ion channel subunit protein.
          Length = 510

 Score = 22.6 bits (46), Expect = 4.6
 Identities = 12/43 (27%), Positives = 20/43 (46%)
 Frame = -2

Query: 449 VATSVEGLPYIRNISR*VQAIVIVVLNVGASSSLVQYYKFFKW 321
           +A  +  + YI  ++R V      +LN+      V Y + FKW
Sbjct: 458 IARHINSVSYIDKVARIVFPASFGLLNICYWVIYVTYQEEFKW 500


>DQ244075-1|ABB36785.1|  548|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 548

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +1

Query: 253 KIIGPLFHLNI 285
           K+I P FHLN+
Sbjct: 139 KLIAPTFHLNV 149


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 223,193
Number of Sequences: 438
Number of extensions: 4677
Number of successful extensions: 5
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 26460186
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)