BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30091 (912 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 25 0.72 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 1.7 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 8.9 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 8.9 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 8.9 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 25.4 bits (53), Expect = 0.72 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Frame = -2 Query: 164 YRGVCIE----SASECVGCTCAREHRRDTPPTSAPHTRTCTPRTLHLTSNKAIS 15 Y G+C E S ++C+GC+ + T PH + + S+ AI+ Sbjct: 75 YLGICAEGMQCSCNKCIGCSAEKFECSKTSNPCLPHRNSDRDLNIRKWSSIAIN 128 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 24.2 bits (50), Expect = 1.7 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -2 Query: 110 REHRRDTPPTSAPHTRTCTPRT 45 R+H + P PH TCT T Sbjct: 1073 RQHTAEGVPEQPPHDTTCTTLT 1094 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 8.9 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 275 IFSILQFFAHHQQ 313 IFS++ F AH QQ Sbjct: 333 IFSVVGFMAHEQQ 345 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 8.9 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 275 IFSILQFFAHHQQ 313 IFS++ F AH QQ Sbjct: 386 IFSVVGFMAHEQQ 398 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.8 bits (44), Expect = 8.9 Identities = 13/45 (28%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = -1 Query: 771 DAQKNLRKSERRIKELTFQAE---EDRKNHERMQDLVDKLQQKIK 646 D + RK +RR ++L + E E+R + ER ++ Q+ K Sbjct: 240 DRNREYRKKDRRYEKLHNEKEKLLEERTSRERYSRSREREQKSYK 284 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,854 Number of Sequences: 438 Number of extensions: 3794 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29630055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -