BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30090 (852 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 26 0.33 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 3.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 3.1 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 3.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 3.1 DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory pro... 22 5.4 AY600516-1|AAT11864.1| 143|Tribolium castaneum optomotor-blind-... 21 9.4 AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-... 21 9.4 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 26.2 bits (55), Expect = 0.33 Identities = 11/48 (22%), Positives = 22/48 (45%) Frame = +2 Query: 698 DRRPRNFWECIVKLETEKYDLEERQKRQDYDLKELKERQKQQLRHKAL 841 D+ P N ++ + K D+E+ DL ++ +Q + H+ L Sbjct: 280 DKNPENTLGTMLSIHPSKLDVEQMNLLHSNDLNMHQQHHQQNMSHEEL 327 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/11 (81%), Positives = 11/11 (100%) Frame = +1 Query: 604 KTKEQLEEEKK 636 KTK++LEEEKK Sbjct: 1068 KTKKELEEEKK 1078 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/11 (81%), Positives = 11/11 (100%) Frame = +1 Query: 604 KTKEQLEEEKK 636 KTK++LEEEKK Sbjct: 1068 KTKKELEEEKK 1078 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/11 (81%), Positives = 11/11 (100%) Frame = +1 Query: 604 KTKEQLEEEKK 636 KTK++LEEEKK Sbjct: 1068 KTKKELEEEKK 1078 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/11 (81%), Positives = 11/11 (100%) Frame = +1 Query: 604 KTKEQLEEEKK 636 KTK++LEEEKK Sbjct: 1068 KTKKELEEEKK 1078 >DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory protein 10 protein. Length = 129 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 695 SDRRPRNFWECIVKLETEKYDLEERQK 775 SDR +N++ C+++ T D EE +K Sbjct: 39 SDRLLKNYFNCLMERGTCSPDGEELKK 65 >AY600516-1|AAT11864.1| 143|Tribolium castaneum optomotor-blind-like protein protein. Length = 143 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 184 SRPSIAGEGDPEFIKR 231 SR +AG+ DPE KR Sbjct: 38 SRWMVAGKADPEMPKR 53 >AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-like protein protein. Length = 134 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 184 SRPSIAGEGDPEFIKR 231 SR +AG+ DPE KR Sbjct: 38 SRWMVAGKADPEMPKR 53 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.313 0.128 0.346 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,208 Number of Sequences: 336 Number of extensions: 2151 Number of successful extensions: 11 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23555563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -