BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30088 (854 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 26 0.38 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 26 0.38 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 24 2.1 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 3.6 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 6.3 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 22 6.3 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 6.3 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 26.2 bits (55), Expect = 0.38 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 5/49 (10%) Frame = +1 Query: 151 QVKL---LAERLYGISVLDLTELN--GYDDKNYKLTEDPNMKNPLITNH 282 Q+KL L E G ++L N G+DD LT D N +NP + + Sbjct: 236 QIKLVEGLEEEAEGAITVELQSENIPGFDDYMASLTPDTNRRNPWFSEY 284 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 26.2 bits (55), Expect = 0.38 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 5/49 (10%) Frame = +1 Query: 151 QVKL---LAERLYGISVLDLTELN--GYDDKNYKLTEDPNMKNPLITNH 282 Q+KL L E G ++L N G+DD LT D N +NP + + Sbjct: 326 QIKLVEGLEEEAEGAITVELQSENIPGFDDYMASLTPDTNRRNPWFSEY 374 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 23.8 bits (49), Expect = 2.1 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +3 Query: 123 GYPSDNRPRAGEAT 164 GYP D +PRAG T Sbjct: 642 GYPFDRQPRAGVET 655 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 23.0 bits (47), Expect = 3.6 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 594 PPDGEWLPSPMDFSNARG 647 PPD W P + F+NA G Sbjct: 104 PPDKVWKPDIVLFNNADG 121 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 22.2 bits (45), Expect = 6.3 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = -2 Query: 745 WHLCRPHAYHSSVY 704 WH+ +P YH +Y Sbjct: 43 WHVDQPTVYHPELY 56 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 22.2 bits (45), Expect = 6.3 Identities = 12/64 (18%), Positives = 29/64 (45%) Frame = -3 Query: 585 LVCLQFVIQISDKFSELIQESFGQGTVLQELSRHVLQQSYGVFLASQVLDRVQVTEDIPY 406 L+C ++ +SD +L S +L + + + L + + +++ ++PY Sbjct: 291 LIC--HILCMSDLHWQLPHNSTNPPNILLYYRDSLALSVFALILTALLRKMQEMSIEVPY 348 Query: 405 WLGT 394 W+ T Sbjct: 349 WIST 352 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 22.2 bits (45), Expect = 6.3 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = -2 Query: 745 WHLCRPHAYHSSVY 704 WH+ +P YH +Y Sbjct: 43 WHVDQPTVYHPELY 56 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 231,035 Number of Sequences: 438 Number of extensions: 5470 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27552579 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -