BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30088 (854 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g31480.1 68417.m04472 coatomer beta subunit, putative / beta-... 31 1.3 At4g11200.1 68417.m01813 hypothetical protein contains weak hit ... 31 1.3 At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp... 31 1.3 At4g03470.1 68417.m00474 ankyrin repeat family protein contains ... 30 2.3 At3g29810.1 68416.m03794 phytochelatin synthetase family protein... 29 3.0 At4g24450.1 68417.m03505 starch excess protein-related similar t... 29 3.9 At4g04885.1 68417.m00711 pre-mRNA cleavage complex-related conta... 28 6.9 At5g54820.1 68418.m06828 F-box family protein contains Pfam:PF00... 28 9.1 At4g31490.1 68417.m04473 coatomer beta subunit, putative / beta-... 28 9.1 At3g51280.1 68416.m05613 male sterility MS5, putative similar to... 28 9.1 >At4g31480.1 68417.m04472 coatomer beta subunit, putative / beta-coat protein, putative / beta-COP, putative similar to Coatomer beta subunit (Beta-coat protein) (Beta-COP) from {Rattus norvegicus} SP|P23514, {Mus musculus} SP|Q9JIF7, {Homo sapiens} SP|P53618; contains Pfam profile: PF01602 Adaptin N terminal region Length = 971 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 503 RTVPCPKLSCISSENLSLIWITNCRQTSIR 592 R V C KL C ++ + IW+ +CRQ+ ++ Sbjct: 639 RIVLCIKLLCHRNDEMKKIWLESCRQSFVK 668 >At4g11200.1 68417.m01813 hypothetical protein contains weak hit to Pfam profile PF03108: MuDR family transposase Length = 462 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +1 Query: 91 TDAKLLLEPGQVIRP-IIDHEQVKLLAERLYGISVLDLTELNGYDDKNYKLTED 249 +DA+L P + I+D E V + AE + + + E Y+D+ Y T+D Sbjct: 269 SDARLSESPDSELEAEIVDEEDVNVKAEEIQVFDIRNYEEQIPYEDEEYPTTDD 322 >At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein similar to SP|Q15459 Splicing factor 3 subunit 1 (Spliceosome associated protein 114) {Homo sapiens}; contains Pfam profiles PF00240: Ubiquitin family, PF01805: Surp module Length = 785 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/54 (25%), Positives = 29/54 (53%) Frame = +1 Query: 106 LLEPGQVIRPIIDHEQVKLLAERLYGISVLDLTELNGYDDKNYKLTEDPNMKNP 267 ++EPG+ + +D E+VKL+AE + ++ + ++ D+ + N K P Sbjct: 345 IVEPGKEVEMEMDEEEVKLVAEGMRAANLEENVKIENVHDEEAPMRIVKNWKRP 398 >At4g03470.1 68417.m00474 ankyrin repeat family protein contains ankyrin repeats, Pfam domain PF00023 Length = 683 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +3 Query: 618 SPMDFSNARGRAKPLPTKDTENMIP 692 S F RG+A PLP KDTE +P Sbjct: 42 SSRGFLRNRGKAIPLPMKDTEKTVP 66 >At3g29810.1 68416.m03794 phytochelatin synthetase family protein / COBRA cell expansion protein COBL2 similar to phytochelatin synthetase [Hordeum vulgare subsp. vulgare] GI:29570314; identified in Roudier, et al, Plant Phys. (2002) 130:538-548 (PMID:12376623); contains Pfam profile PF04833: Phytochelatin synthetase-like conserved region Length = 441 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +2 Query: 419 SVTCTLSRTWEARNTP*DCWSTCRESS*RTVPCPKLSC 532 ++TCT S+ + AR TP C S + VPCP SC Sbjct: 209 NITCTYSQ-FLARKTPTCCVSLSAFYNETIVPCPTCSC 245 >At4g24450.1 68417.m03505 starch excess protein-related similar to SEX1 [Arabidopsis thaliana] GI:12044358 Length = 1284 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = +2 Query: 620 AHGLQQRQGQSQAAAYQRYREYDSVVVEIH 709 AH + R+G+ Q++A ++ +YD+ V E+H Sbjct: 139 AHKIWDRKGRPQSSAREQQIDYDNAVRELH 168 >At4g04885.1 68417.m00711 pre-mRNA cleavage complex-related contains weak similarity to Pre-mRNA cleavage complex II protein Pcf11 (Fragment) (Swiss-Prot:O94913) [Homo sapiens] Length = 808 Score = 28.3 bits (60), Expect = 6.9 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 2/79 (2%) Frame = +1 Query: 313 NSIDSQNVGVVEAQNEIM-NFLATRSVTCPKPVRNIFGHL-HSIEDLGGKKHAVRLLEYV 486 N + ++ + QN+++ N+L + S P+P++++ H+ H G L Sbjct: 516 NQVSQSHLNDMTQQNQMLVNYLPSSSAMAPRPMQSLLTHVSHGYPPHGSTIRP--SLSIQ 573 Query: 487 PGELLKNCPLSEALLYQLG 543 GE + PLS +L Q+G Sbjct: 574 GGEAMH--PLSSGVLSQIG 590 >At5g54820.1 68418.m06828 F-box family protein contains Pfam:PF00646 F-box domain Length = 472 Score = 27.9 bits (59), Expect = 9.1 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +1 Query: 1 QTSVHTQECNGTLVLIENC 57 +T +HT+E NG ++L+ NC Sbjct: 335 RTKMHTKEFNGIILLLNNC 353 >At4g31490.1 68417.m04473 coatomer beta subunit, putative / beta-coat protein, putative / beta-COP, putative similar to Coatomer beta subunit (Beta-coat protein) (Beta-COP) from {Rattus norvegicus} SP|P23514, {Mus musculus} SP|Q9JIF7, {Homo sapiens} SP|P53618; contains Pfam profile: PF01602 Adaptin N terminal region Length = 948 Score = 27.9 bits (59), Expect = 9.1 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 503 RTVPCPKLSCISSENLSLIWITNCRQTSIR 592 R + C KL C + + IW+ +CRQ+ ++ Sbjct: 616 RIMLCIKLLCHRNVEMKKIWLESCRQSFVK 645 >At3g51280.1 68416.m05613 male sterility MS5, putative similar to male sterility MS5 [Arabidopsis thaliana] GI:3859112; contains Pfam profile PF00515 TPR Domain Length = 430 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 199 LTELNGYDDKNYKLTEDPNMKNPLITNHSPY 291 L+ +GY D+N K++ +P + NPL + P+ Sbjct: 304 LSNGDGYGDENVKMSVNPVVVNPLRVDAKPF 334 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,970,432 Number of Sequences: 28952 Number of extensions: 391927 Number of successful extensions: 1266 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1208 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1266 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1989897600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -