BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30087 (810 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g47500.1 68415.m05929 kinesin motor protein-related 50 1e-06 At5g27000.1 68418.m03221 kinesin motor protein-related non-conse... 49 4e-06 At5g41310.1 68418.m05020 kinesin motor protein-related 44 9e-05 At1g63640.2 68414.m07198 kinesin motor protein-related C-termina... 43 2e-04 At1g63640.1 68414.m07197 kinesin motor protein-related C-termina... 43 2e-04 At3g10310.1 68416.m01237 kinesin motor protein-related similar t... 42 4e-04 At1g09170.1 68414.m01024 kinesin motor protein-related similar t... 41 8e-04 At3g44730.1 68416.m04814 kinesin motor protein-related similar t... 36 0.042 At5g35700.1 68418.m04269 fimbrin-like protein, putative similar ... 35 0.073 At5g48460.1 68418.m05992 fimbrin-like protein, putative strong s... 34 0.097 At4g26700.1 68417.m03848 fimbrin-like protein (FIM1) identical t... 34 0.13 At5g55400.1 68418.m06902 fimbrin-like protein, putative similar ... 33 0.17 At2g04750.1 68415.m00485 fimbrin-like protein, putative similar ... 33 0.30 At5g62240.1 68418.m07815 expressed protein various predicted pro... 31 0.68 At5g25475.2 68418.m03031 expressed protein 31 0.90 At5g25475.1 68418.m03030 expressed protein 31 0.90 At3g59100.1 68416.m06589 glycosyl transferase family 48 protein ... 31 0.90 At3g11170.1 68416.m01355 omega-3 fatty acid desaturase, chloropl... 30 2.1 At5g25470.2 68418.m03029 expressed protein 29 2.8 At5g25470.1 68418.m03028 expressed protein 29 2.8 At2g17010.1 68415.m01961 mechanosensitive ion channel domain-con... 29 2.8 At2g25730.1 68415.m03084 expressed protein 29 3.7 At3g07070.1 68416.m00840 protein kinase family protein contains ... 29 4.8 At2g46510.1 68415.m05796 basic helix-loop-helix (bHLH) family pr... 29 4.8 At2g31010.1 68415.m03781 protein kinase family protein contains ... 29 4.8 At2g45600.1 68415.m05670 expressed protein low similarity to PrM... 28 6.4 >At2g47500.1 68415.m05929 kinesin motor protein-related Length = 974 Score = 50.4 bits (115), Expect = 1e-06 Identities = 34/101 (33%), Positives = 51/101 (50%), Gaps = 12/101 (11%) Frame = +3 Query: 90 DVLGEPLPNGAYEDVLRDGVILCKLANKLAPGSVKKIQERGTN------------FQLME 233 D+ EP G LR G+ILCK+ NK+ PG+V K+ E + FQ E Sbjct: 65 DLPAEPTEEGLRLG-LRSGIILCKVLNKVQPGAVSKVVESPCDAILVADGAPLSAFQYFE 123 Query: 234 NIQRFQAAIKKYGVPEEEIFQTADLFERRNIPQVTLCLYAL 356 N++ F AI++ G P F+ +DL + N +V C+ A+ Sbjct: 124 NVRNFLVAIQEMGFP---TFEASDLEQGGNASRVVNCVLAI 161 >At5g27000.1 68418.m03221 kinesin motor protein-related non-consensus AT donor splice site at exon 12; non-consensus AC acceptor splice site at exon 13 Length = 987 Score = 48.8 bits (111), Expect = 4e-06 Identities = 34/113 (30%), Positives = 56/113 (49%), Gaps = 17/113 (15%) Frame = +3 Query: 69 EVLTWISDVLG----EPLPNGAYEDV----LRDGVILCKLANKLAPGSVKKIQERGTN-- 218 E W+ D++G + P E+ LR G++LC + NK+ PGSV K+ E + Sbjct: 49 EAAGWLRDMIGVSNGKDFPGEPSEEEFRLGLRSGIVLCNVLNKVNPGSVSKVVEAPDDVA 108 Query: 219 -------FQLMENIQRFQAAIKKYGVPEEEIFQTADLFERRNIPQVTLCLYAL 356 FQ ENI+ F AI++ G+P F+ +D+ + ++ C+ AL Sbjct: 109 DGAALSAFQYFENIRNFLVAIEEMGLPS---FEASDMEKGGKSIRIVNCILAL 158 >At5g41310.1 68418.m05020 kinesin motor protein-related Length = 961 Score = 44.4 bits (100), Expect = 9e-05 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 6/85 (7%) Frame = +3 Query: 51 NKDQEQEVLTWISDVLGE-PLPNGAYEDVLR----DGVILCKLANKLAPGSVKKIQERGT 215 NK Q ++ W+++ L LP A E+ LR DG +LC L N+L+PGS++ G Sbjct: 39 NKQGHQSLVEWLNETLPYLNLPWEASEEELRACLVDGTVLCNLLNQLSPGSMR----MGG 94 Query: 216 NFQL-MENIQRFQAAIKKYGVPEEE 287 +F+ NI+RF AA+ + +P E Sbjct: 95 SFEPGCVNIERFLAAMDEMTLPRFE 119 >At1g63640.2 68414.m07198 kinesin motor protein-related C-terminal region is similar to C-term region of kinesin motor protein GB:AAB51397 (Mus musculus); contains Pfam profile: PF00225 Kinesin motor domain Length = 1065 Score = 43.2 bits (97), Expect = 2e-04 Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 6/86 (6%) Frame = +3 Query: 51 NKDQEQEVLTWISDVLGE-PLPNGAYED----VLRDGVILCKLANKLAPGSVKKIQERGT 215 +K Q ++ W+++ L LP A ED LRDG +LC L N+L+PGS++ G Sbjct: 38 SKKGHQSLVEWLNETLPYLKLPWEASEDELRACLRDGTVLCSLLNQLSPGSMR----MGG 93 Query: 216 NFQ-LMENIQRFQAAIKKYGVPEEEI 290 +F+ I+RF A+ + +P E+ Sbjct: 94 SFEPASVKIERFLTAMDEMALPRFEV 119 >At1g63640.1 68414.m07197 kinesin motor protein-related C-terminal region is similar to C-term region of kinesin motor protein GB:AAB51397 (Mus musculus); contains Pfam profile: PF00225 Kinesin motor domain Length = 1064 Score = 43.2 bits (97), Expect = 2e-04 Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 6/86 (6%) Frame = +3 Query: 51 NKDQEQEVLTWISDVLGE-PLPNGAYED----VLRDGVILCKLANKLAPGSVKKIQERGT 215 +K Q ++ W+++ L LP A ED LRDG +LC L N+L+PGS++ G Sbjct: 38 SKKGHQSLVEWLNETLPYLKLPWEASEDELRACLRDGTVLCSLLNQLSPGSMR----MGG 93 Query: 216 NFQ-LMENIQRFQAAIKKYGVPEEEI 290 +F+ I+RF A+ + +P E+ Sbjct: 94 SFEPASVKIERFLTAMDEMALPRFEV 119 >At3g10310.1 68416.m01237 kinesin motor protein-related similar to carboxy-terminal kinesin 2 GB:P79955 [Xenopus laevis] Length = 897 Score = 42.3 bits (95), Expect = 4e-04 Identities = 31/112 (27%), Positives = 53/112 (47%), Gaps = 16/112 (14%) Frame = +3 Query: 69 EVLTWISDVLGE-PLPNGAYE----DVLRDGVILCKLANKLAPGSVKKIQERGT------ 215 + + W+ V+G+ +PN E LR+G+ILC NK+ PG+V K+ E + Sbjct: 24 QAVQWLKSVVGQLGIPNQPSEKEFISCLRNGMILCNAINKIHPGAVSKVVENYSYLNGEY 83 Query: 216 ----NFQLMENIQRFQAAIKKYGVPEEEIFQ-TADLFERRNIPQVTLCLYAL 356 +Q EN++ F A++ +P E D E ++ +V C+ L Sbjct: 84 QLPPAYQYFENVRNFLVALETLRLPGFEASDLEKDNLESGSVTKVVDCILGL 135 >At1g09170.1 68414.m01024 kinesin motor protein-related similar to GB:AAB61066 Length = 1010 Score = 41.1 bits (92), Expect = 8e-04 Identities = 30/116 (25%), Positives = 53/116 (45%), Gaps = 20/116 (17%) Frame = +3 Query: 69 EVLTWISDVLG----EPLPNGAYED----VLRDGVILCKLANKLAPGSVKKIQERGTN-- 218 E W+ + LG LP E+ LR G++LC + N++ PG+V K+ E + Sbjct: 59 EAARWVRNTLGVVGGRDLPADPSEEDFRIALRSGILLCNVLNRVKPGAVPKVVEAPNDPL 118 Query: 219 ----------FQLMENIQRFQAAIKKYGVPEEEIFQTADLFERRNIPQVTLCLYAL 356 FQ EN++ F +++ G+P F+ +D + ++ C+ AL Sbjct: 119 VNQDGAALSAFQYFENLRNFLVFVEEMGIP---TFEVSDFEKGGKSARIVECVLAL 171 >At3g44730.1 68416.m04814 kinesin motor protein-related similar to 4 other kinesin-like proteins of A. thaliana: F02P16.12 (PID:g2191180), katA (D11371), katB (D21137), and katC (D21138); contains non-consensus AT-AC splice sites at intron 10 Length = 1087 Score = 35.5 bits (78), Expect = 0.042 Identities = 19/39 (48%), Positives = 24/39 (61%), Gaps = 4/39 (10%) Frame = +3 Query: 102 EPLPNGAYED----VLRDGVILCKLANKLAPGSVKKIQE 206 E LP ED LR+G+ILC + NK+ PGSV K+ E Sbjct: 7 ETLPEKPSEDEFSLALRNGLILCNVLNKVNPGSVLKVVE 45 >At5g35700.1 68418.m04269 fimbrin-like protein, putative similar to fimbrin-like protein (ATFIM1) [Arabidopsis thaliana] GI:2905893, fimbrin [Schizosaccharomyces pombe] GI:3057144; contains Pfam profile PF00307: Calponin homology (CH) domain Length = 687 Score = 34.7 bits (76), Expect = 0.073 Identities = 18/39 (46%), Positives = 25/39 (64%) Frame = +3 Query: 102 EPLPNGAYEDVLRDGVILCKLANKLAPGSVKKIQERGTN 218 +P N A+ D+++DGV+LCKL N PG+ I ER N Sbjct: 149 DPATN-AFFDLVKDGVLLCKLINVAVPGT---IDERAIN 183 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +3 Query: 81 WISDVLGEPLPNGAYEDVLRDGVILCKLANKLAPGSV 191 WI+ + N +ED LR+G +L ++ +K++PGSV Sbjct: 401 WINSLGTATYVNNVFED-LRNGWVLLEVLDKVSPGSV 436 >At5g48460.1 68418.m05992 fimbrin-like protein, putative strong similarity to fimbrin-like protein AtFim2 [Arabidopsis thaliana] GI:2737926; contains Pfam profile PF00307: Calponin homology (CH) domain Length = 654 Score = 34.3 bits (75), Expect = 0.097 Identities = 20/44 (45%), Positives = 25/44 (56%) Frame = +3 Query: 105 PLPNGAYEDVLRDGVILCKLANKLAPGSVKKIQERGTNFQLMEN 236 P N +E V +DGV+LCKL N PG+ I ER N + M N Sbjct: 152 PSSNDLFE-VAKDGVLLCKLINVAVPGT---IDERAINTKSMLN 191 Score = 31.9 bits (69), Expect = 0.52 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +3 Query: 60 QEQEVLTWISDVLGEPLPNGAYEDVLRDGVILCKLANKLAPGSV 191 +E+ WI+ G N +ED LRDG IL + +K++PG V Sbjct: 396 EEKAFRFWINSFDGSVYINNVFED-LRDGWILLQTLDKVSPGIV 438 >At4g26700.1 68417.m03848 fimbrin-like protein (FIM1) identical to fimbrin-like protein (ATFIM1) [Arabidopsis thaliana] GI:2905893 Length = 687 Score = 33.9 bits (74), Expect = 0.13 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +3 Query: 102 EPLPNGAYEDVLRDGVILCKLANKLAPGSVKKIQERGTNFQLMEN 236 +P N YE +++DGV+LCKL N PG+ I ER N + + N Sbjct: 150 DPHSNQLYE-LVKDGVLLCKLINVAVPGT---IDERAINTKRVLN 190 >At5g55400.1 68418.m06902 fimbrin-like protein, putative similar to fimbrin-like protein (ATFIM1) [Arabidopsis thaliana] GI:2905893; contains Pfam profile PF00307: Calponin homology (CH) domain Length = 714 Score = 33.5 bits (73), Expect = 0.17 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +3 Query: 102 EPLPNGAYEDVLRDGVILCKLANKLAPGSVKKIQERGTNFQLMEN 236 +P N YE +++DGV+LCKL N PG+ I ER N + + N Sbjct: 151 DPDSNDLYE-LVKDGVLLCKLINIAVPGT---IDERAINTKRVLN 191 Score = 31.1 bits (67), Expect = 0.90 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +3 Query: 81 WISDVLGEPLPNGAYEDVLRDGVILCKLANKLAPGSV 191 WI+ + E N +EDV R+G IL ++ +K+ PGSV Sbjct: 402 WINSLGIESYVNNVFEDV-RNGWILLEVVDKVYPGSV 437 >At2g04750.1 68415.m00485 fimbrin-like protein, putative similar to fimbrin-like protein (ATFIM1) [Arabidopsis thaliana] GI:2905893; contains Pfam profile PF00307: Calponin homology (CH) domain Length = 652 Score = 32.7 bits (71), Expect = 0.30 Identities = 17/38 (44%), Positives = 23/38 (60%) Frame = +3 Query: 105 PLPNGAYEDVLRDGVILCKLANKLAPGSVKKIQERGTN 218 P N + D+++DGV+LCKL N PG+ I ER N Sbjct: 144 PTTNALF-DLVKDGVLLCKLINIAVPGT---IDERAIN 177 >At5g62240.1 68418.m07815 expressed protein various predicted proteins, Arabidopsis thaliana; expression supported by MPSS Length = 366 Score = 31.5 bits (68), Expect = 0.68 Identities = 19/55 (34%), Positives = 27/55 (49%) Frame = +3 Query: 153 LCKLANKLAPGSVKKIQERGTNFQLMENIQRFQAAIKKYGVPEEEIFQTADLFER 317 L K +AP V K+Q + TN Q E ++ K VP+E +TA+ ER Sbjct: 161 LAKFGENVAPVLVSKLQNQDTNRQKQEAKVAHVSSRAKLTVPKEPNLRTAERSER 215 >At5g25475.2 68418.m03031 expressed protein Length = 282 Score = 31.1 bits (67), Expect = 0.90 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -1 Query: 102 LPKHQRSK*EPLVLGPCFWQALCAGEIW 19 LPK+ K + V PCFW++L G+ W Sbjct: 2 LPKNAIEKIQANVSKPCFWKSLSPGQTW 29 >At5g25475.1 68418.m03030 expressed protein Length = 282 Score = 31.1 bits (67), Expect = 0.90 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -1 Query: 102 LPKHQRSK*EPLVLGPCFWQALCAGEIW 19 LPK+ K + V PCFW++L G+ W Sbjct: 2 LPKNAIEKIQANVSKPCFWKSLSPGQTW 29 >At3g59100.1 68416.m06589 glycosyl transferase family 48 protein contains Pfam profile: PF02364 1,3-beta-glucan synthase Length = 1934 Score = 31.1 bits (67), Expect = 0.90 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = -3 Query: 187 DPGANLLANLQRITPSLSTSSYAPFGSGSPKTSEIQVRTSCSWSLF 50 D A+ N ITP + +G PKT+ ++VRT W+LF Sbjct: 444 DLKADFFLNSDEITPQDERLNQVTYGKSKPKTNFVEVRT--FWNLF 487 >At3g11170.1 68416.m01355 omega-3 fatty acid desaturase, chloroplast (FAD7) (FADD) identical to omega-3 fatty acid desaturase, chloroplast precursor SP:P46310 [Arabidopsis thaliana (Mouse-ear cress)]; identical to Pfam profile PF00487: Fatty acid desaturase; identical to cDNA plastid fatty acid desaturase GI:809491 Length = 446 Score = 29.9 bits (64), Expect = 2.1 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = -3 Query: 193 FTDPGANLLANLQRITPSLSTSSYAPFGSGSPKTSEIQVRT--SCSWSL 53 +T P +N L+N + PSLS+SSY S SP + + R + +W+L Sbjct: 18 YTTPRSNFLSNNNKFRPSLSSSSYKT--SSSPLSFGLNSRDGFTRNWAL 64 >At5g25470.2 68418.m03029 expressed protein Length = 280 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -1 Query: 102 LPKHQRSK*EPLVLGPCFWQALCAGEIW 19 LP++ K + V PCFW++L G+ W Sbjct: 2 LPRNATDKIQGNVSKPCFWKSLSPGQNW 29 >At5g25470.1 68418.m03028 expressed protein Length = 280 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -1 Query: 102 LPKHQRSK*EPLVLGPCFWQALCAGEIW 19 LP++ K + V PCFW++L G+ W Sbjct: 2 LPRNATDKIQGNVSKPCFWKSLSPGQNW 29 >At2g17010.1 68415.m01961 mechanosensitive ion channel domain-containing protein / MS ion channel domain-containing protein contains Pfam profile PF00924: Mechanosensitive ion channel Length = 779 Score = 29.5 bits (63), Expect = 2.8 Identities = 27/103 (26%), Positives = 47/103 (45%), Gaps = 3/103 (2%) Frame = +3 Query: 15 ETRFRLH--TMPARNKDQEQEVLTWIS-DVLGEPLPNGAYEDVLRDGVILCKLANKLAPG 185 ETR R++ + A N + +++ +S L E + YED + K A A Sbjct: 406 ETRSRMNHKNISAWNMKRLMKIVRNVSLTTLDEQMLESTYEDESTRQIRSEKEAKAAARK 465 Query: 186 SVKKIQERGTNFQLMENIQRFQAAIKKYGVPEEEIFQTADLFE 314 K +++RG + +E++ RF + E+E +T LFE Sbjct: 466 IFKNVEQRGAKYIYLEDLMRF--------LREDEAMKTMGLFE 500 >At2g25730.1 68415.m03084 expressed protein Length = 2464 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 478 RLSSALWARSCSSVKVRSFLSAI 410 R + LW+RSC S + SFLS I Sbjct: 52 RFDNVLWSRSCPSPSLLSFLSTI 74 >At3g07070.1 68416.m00840 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 414 Score = 28.7 bits (61), Expect = 4.8 Identities = 20/64 (31%), Positives = 28/64 (43%) Frame = +3 Query: 48 RNKDQEQEVLTWISDVLGEPLPNGAYEDVLRDGVILCKLANKLAPGSVKKIQERGTNFQL 227 R KD EQ ++TW V EP D +GV K N+ + +QE T L Sbjct: 287 RPKD-EQNLVTWAQPVFKEPSRFPELADPSLEGVFPEKALNQAVAVAAMCLQEEATVRPL 345 Query: 228 MENI 239 M ++ Sbjct: 346 MSDV 349 >At2g46510.1 68415.m05796 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 566 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 Query: 131 CAKGRCDPLQIGQQISSWISEKNPRERNQLPAHG 232 C + R L G I S + EK PR+R + PA+G Sbjct: 356 CTEKRPVSLLAGAGIVSVVDEKRPRKRGRKPANG 389 >At2g31010.1 68415.m03781 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 775 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +3 Query: 81 WISDVLGEPLPNGAYEDVLRDGVILCKLANKL-APGSVKKIQERGTNFQLM 230 W + +L EP+PNG Y V+ D + +L N+L P + + E G +++ Sbjct: 57 WDTGILSEPIPNGFY-SVVPDKRVK-ELYNRLPTPSELHALGEEGVRIEVI 105 >At2g45600.1 68415.m05670 expressed protein low similarity to PrMC3 [Pinus radiata] GI:5487873 Length = 329 Score = 28.3 bits (60), Expect = 6.4 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = +3 Query: 12 LETRFRL---HTMPARNKDQEQEVLTWISDVLGEPLPNGAYEDVLRDGVILCK 161 L +RL H +PA +D + +L W+ D P+ G + L+DGV K Sbjct: 103 LSVEYRLAPEHRLPAAYEDAVEAIL-WLRDQARGPINGGDCDTWLKDGVDFSK 154 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,489,329 Number of Sequences: 28952 Number of extensions: 428300 Number of successful extensions: 1231 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 1170 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1228 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1843581600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -