BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30086X (557 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P05661 Cluster: Myosin heavy chain, muscle; n=90; Bilat... 42 0.010 UniRef50_A4EB73 Cluster: Putative uncharacterized protein; n=1; ... 35 1.5 UniRef50_Q5TXC1 Cluster: ENSANGP00000026652; n=1; Anopheles gamb... 35 1.5 UniRef50_Q0IFM4 Cluster: Putative uncharacterized protein; n=1; ... 34 2.6 UniRef50_Q235W1 Cluster: Putative uncharacterized protein; n=1; ... 33 4.5 UniRef50_Q30UI2 Cluster: Exo-beta-1 3-glucanase-like; n=1; Thiom... 33 6.0 UniRef50_Q8I5C8 Cluster: Putative uncharacterized protein; n=3; ... 33 6.0 UniRef50_Q6U7U4 Cluster: Putative uncharacterized protein hypP2;... 33 6.0 UniRef50_Q67PE6 Cluster: Putative uncharacterized protein; n=1; ... 32 7.9 >UniRef50_P05661 Cluster: Myosin heavy chain, muscle; n=90; Bilateria|Rep: Myosin heavy chain, muscle - Drosophila melanogaster (Fruit fly) Length = 1962 Score = 41.9 bits (94), Expect = 0.010 Identities = 27/50 (54%), Positives = 30/50 (60%), Gaps = 2/50 (4%) Frame = -3 Query: 555 EQAISKFXXXXXXXXXXXGVSPAPQRS--RPALADGLGTFPPRFDLAPED 412 EQAISKF G SPAP+ + RP DGL FPPRFDLAPE+ Sbjct: 1913 EQAISKFRAKGRAGSVGRGASPAPRATSVRPQF-DGLA-FPPRFDLAPEN 1960 >UniRef50_A4EB73 Cluster: Putative uncharacterized protein; n=1; Collinsella aerofaciens ATCC 25986|Rep: Putative uncharacterized protein - Collinsella aerofaciens ATCC 25986 Length = 409 Score = 34.7 bits (76), Expect = 1.5 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -1 Query: 164 SASECVGCTCAREHRRDTPPTSAPHTRTCTPRT 66 SAS C TC+R R TPP + H T RT Sbjct: 331 SASTCTATTCSRTCRSTTPPAATRHPETSADRT 363 >UniRef50_Q5TXC1 Cluster: ENSANGP00000026652; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000026652 - Anopheles gambiae str. PEST Length = 1333 Score = 34.7 bits (76), Expect = 1.5 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -1 Query: 188 YYRGVCIESASECVGCTCAREHRRDTPPTSAPHTRTCTPR 69 Y G ++S C C C R R+ TP AP + CTPR Sbjct: 226 YPDGEKMKSEDPCEVCYCIRGQRKCTPKKCAPTIKGCTPR 265 >UniRef50_Q0IFM4 Cluster: Putative uncharacterized protein; n=1; Aedes aegypti|Rep: Putative uncharacterized protein - Aedes aegypti (Yellowfever mosquito) Length = 1131 Score = 33.9 bits (74), Expect = 2.6 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = -1 Query: 188 YYRGVCIESASECVGCTCAREHRRDTPPTSAPHTRTCTPR 69 Y G I S C C C R ++ TP AP + CTPR Sbjct: 255 YPEGERIASQDPCQVCFCIRGDQKCTPKKCAPAIKGCTPR 294 >UniRef50_Q235W1 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 380 Score = 33.1 bits (72), Expect = 4.5 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Frame = +3 Query: 174 YSTVINNIN-KYQQRYKIAFRKNIRSLKCI---YFCLAYKKKRIAYLVFYSFSLIINS 335 +++ N +N KYQ+ Y + + I LKC+ +A K I + F +FSL +NS Sbjct: 126 FNSQFNEVNYKYQEIYSLKLQNKINCLKCLNGETLIVATKSGPIHIIKFANFSLYLNS 183 >UniRef50_Q30UI2 Cluster: Exo-beta-1 3-glucanase-like; n=1; Thiomicrospira denitrificans ATCC 33889|Rep: Exo-beta-1 3-glucanase-like - Thiomicrospira denitrificans (strain ATCC 33889 / DSM 1351) Length = 638 Score = 32.7 bits (71), Expect = 6.0 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = -2 Query: 307 NTKYAILFFL*AKQKYIHFRDLMFLRKAIL*RC*YLFILFITVEY 173 NT +AILF L +Q + RD+ A L C ++FI ++T+ Y Sbjct: 350 NTLFAILFTLSLEQYSVSVRDIWEFSWAALVLCVHIFIYYLTLAY 394 >UniRef50_Q8I5C8 Cluster: Putative uncharacterized protein; n=3; Plasmodium|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 1834 Score = 32.7 bits (71), Expect = 6.0 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +3 Query: 258 IYFCLAYKKKRIAYLVFYSFSLIINS*CIKSYVFNEKSVQSVFMFCS 398 I+F + Y K+++ + F + + + N+ K Y+FNE + + FCS Sbjct: 878 IHFYMYYYKQKLKEIFFNNINELRNN-IFKEYIFNENRMLDILTFCS 923 >UniRef50_Q6U7U4 Cluster: Putative uncharacterized protein hypP2; n=1; Moniliophthora perniciosa|Rep: Putative uncharacterized protein hypP2 - Crinipellis perniciosa (Witches'-broom disease fungus) (Marasmiusperniciosus) Length = 407 Score = 32.7 bits (71), Expect = 6.0 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = -1 Query: 299 ICNSFFFVSQTKIYTL*GSNVFTKGYFVTLLIFIYIIY 186 + NS+ F+ TKI ++F K F+ L++FI+II+ Sbjct: 262 VSNSYIFLILTKISKKFKDSIFLKYIFIILILFIFIIF 299 >UniRef50_Q67PE6 Cluster: Putative uncharacterized protein; n=1; Symbiobacterium thermophilum|Rep: Putative uncharacterized protein - Symbiobacterium thermophilum Length = 539 Score = 32.3 bits (70), Expect = 7.9 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 6/52 (11%) Frame = +1 Query: 415 FGRQVEPRWEGAQAVSKGGARALGRRADSSRCRTR------ASLAAELADGL 552 FGRQ+E R++ + + GAR GR+ ++ R R A++A +LA GL Sbjct: 53 FGRQMERRFKEIEHARRDGARKKGRKPEAKALRRRLTLMDPAAVARDLAAGL 104 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 493,064,994 Number of Sequences: 1657284 Number of extensions: 9772435 Number of successful extensions: 32015 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 30744 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31996 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 37071859483 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -