BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30085X (441 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr 2||... 118 4e-28 SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomy... 56 2e-09 SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces pomb... 56 3e-09 SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit Arp42|Sc... 51 7e-08 SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex s... 42 4e-05 SPAC630.03 |arp3|act2|actin-like protein Arp3|Schizosaccharomyce... 37 0.002 SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit Arp9|Schizosa... 28 0.73 SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces pombe... 27 0.97 SPBC2D10.03c |||DUF866 domain protein|Schizosaccharomyces pombe|... 25 3.9 SPCC1682.02c |mcm3||MCM complex subunit Mcm3|Schizosaccharomyces... 25 5.2 SPAC664.02c |||actin-like protein Arp8 |Schizosaccharomyces pomb... 25 5.2 SPCC162.02c |||AMP-binding dehydrogenase |Schizosaccharomyces po... 25 5.2 SPBC30D10.06 |lsm4||U6 snRNP-associated protein Lsm4|Schizosacch... 24 9.0 >SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr 2|||Manual Length = 375 Score = 118 bits (284), Expect = 4e-28 Identities = 52/59 (88%), Positives = 58/59 (98%) Frame = -3 Query: 439 ITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 263 I ALAPS++K+KI+APPERKYSVWIGGSILASLSTFQQMWISK+EYDESGPGIV+RKCF Sbjct: 317 IQALAPSSMKVKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVYRKCF 375 >SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomyces pombe|chr 2|||Manual Length = 433 Score = 56.0 bits (129), Expect = 2e-09 Identities = 22/44 (50%), Positives = 33/44 (75%), Gaps = 3/44 (6%) Frame = -3 Query: 388 ERKYSVWIGGSILASLSTFQQMWISKEEYDESGP---GIVHRKC 266 ER Y+ W+GGSIL+SL TF Q+WIS++EY+E G ++ ++C Sbjct: 389 ERSYASWLGGSILSSLGTFHQLWISRQEYEEHGSDRLALIEKRC 432 >SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 379 Score = 55.6 bits (128), Expect = 3e-09 Identities = 25/59 (42%), Positives = 42/59 (71%) Frame = -3 Query: 439 ITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 263 + A++ ++KI A PER ++ W+GGSILASLSTF+++ I+ EEY ++ ++ R+ F Sbjct: 322 LRAISGKKNQVKIYASPERMHNAWLGGSILASLSTFRRLLITSEEY-KNDQNVIFRRRF 379 >SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit Arp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 430 Score = 51.2 bits (117), Expect = 7e-08 Identities = 20/29 (68%), Positives = 24/29 (82%) Frame = -3 Query: 376 SVWIGGSILASLSTFQQMWISKEEYDESG 290 +VW GGSILASL FQ +W+SK+EYDE G Sbjct: 390 AVWFGGSILASLDNFQHLWVSKQEYDEVG 418 >SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex subunit Arp2|Schizosaccharomyces pombe|chr 1|||Manual Length = 390 Score = 41.9 bits (94), Expect = 4e-05 Identities = 18/42 (42%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = -3 Query: 412 KIKIIAPPERKYSVWIGGSILAS-LSTFQQMWISKEEYDESG 290 K+KI P R+++V+IGG++LA ++ MW+SK E++E G Sbjct: 337 KVKIEDAPRRRHAVFIGGAVLADIMAQNDHMWVSKAEWEEYG 378 >SPAC630.03 |arp3|act2|actin-like protein Arp3|Schizosaccharomyces pombe|chr 1|||Manual Length = 427 Score = 36.7 bits (81), Expect = 0.002 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = -3 Query: 415 IKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHR 272 + + +I+ ++ +VW GGS+LA F +K +Y+E G I R Sbjct: 372 VDVNVISHKRQRNAVWFGGSLLAQTPEFGSYCHTKADYEEYGASIARR 419 >SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit Arp9|Schizosaccharomyces pombe|chr 1|||Manual Length = 523 Score = 27.9 bits (59), Expect = 0.73 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 3/37 (8%) Frame = -3 Query: 370 WIGGSILASLSTFQQM---WISKEEYDESGPGIVHRK 269 ++GGSI+A S + + +++ EEY + GP +H K Sbjct: 486 FLGGSIVAKTSFNESVSSHYVTLEEYAQHGPTAIHTK 522 >SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces pombe|chr 2|||Manual Length = 721 Score = 27.5 bits (58), Expect = 0.97 Identities = 13/51 (25%), Positives = 22/51 (43%) Frame = -3 Query: 439 ITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGP 287 +T++ P I + W G S + F+ +++EEY E GP Sbjct: 658 LTSIMPVGSSINVFRASNPLLDAWKGASEWSVTEKFKAAKVTREEYLEKGP 708 >SPBC2D10.03c |||DUF866 domain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 157 Score = 25.4 bits (53), Expect = 3.9 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 207 ELGRAQHHTAPGSRGRAA*KHLRWT 281 E+ R++ H+ PGS+G A +L WT Sbjct: 46 EISRSETHSIPGSKGEA---NLIWT 67 >SPCC1682.02c |mcm3||MCM complex subunit Mcm3|Schizosaccharomyces pombe|chr 3|||Manual Length = 879 Score = 25.0 bits (52), Expect = 5.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 419 DHQDQDHRSPREEVLRMDRWIHPG 348 D D+ R+ E VLRM R++ PG Sbjct: 499 DIDDKKDRALSEHVLRMHRYLPPG 522 >SPAC664.02c |||actin-like protein Arp8 |Schizosaccharomyces pombe|chr 1|||Manual Length = 620 Score = 25.0 bits (52), Expect = 5.2 Identities = 11/50 (22%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Frame = -3 Query: 409 IKIIAPP---ERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRK 269 I +I PP + ++ W G I + ++WI ++ G ++ K Sbjct: 563 ISVIPPPRSMDAQFVAWKGACIYNRIRIVSELWIKNSDWKMLGSRVLQYK 612 >SPCC162.02c |||AMP-binding dehydrogenase |Schizosaccharomyces pombe|chr 3|||Manual Length = 981 Score = 25.0 bits (52), Expect = 5.2 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 2/58 (3%) Frame = -1 Query: 216 VRVLNATVSTLYLVIP--EN*TSNLTPSILM*FIVKFYINLISFLFLLYTRDRCGSQR 49 VR +A S +L P N SN TP+ + I K N+ S + L D C R Sbjct: 575 VRFFHAIQSHFHLEGPIRYNMNSNCTPNSIASIIQKKSYNVSSITYELLNEDACALSR 632 >SPBC30D10.06 |lsm4||U6 snRNP-associated protein Lsm4|Schizosaccharomyces pombe|chr 2|||Manual Length = 121 Score = 24.2 bits (50), Expect = 9.0 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +3 Query: 195 RLRSELGRAQH-HTAPGSRGRAA*KHL 272 R R + GR + HTAP RGR H+ Sbjct: 95 RGRGQRGRGNYGHTAPNRRGRGRGGHM 121 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,474,291 Number of Sequences: 5004 Number of extensions: 25068 Number of successful extensions: 51 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 160149590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -