Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV30084X
         (319 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L04753-1|AAA29357.1|  511|Anopheles gambiae alpha-amylase protein.     23   2.8  
AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p...    23   3.6  

>L04753-1|AAA29357.1|  511|Anopheles gambiae alpha-amylase protein.
          Length = 511

 Score = 23.0 bits (47), Expect = 2.8
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = +3

Query: 267 LRHWWGSGDS 296
           LRHWW +G++
Sbjct: 412 LRHWWDNGNN 421


>AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein
           protein.
          Length = 3325

 Score = 22.6 bits (46), Expect = 3.6
 Identities = 10/34 (29%), Positives = 16/34 (47%)
 Frame = +1

Query: 43  IYTCFQITHYEYNGNLTFKTYLYNN*HGITDSAS 144
           +  C  I+H++  G      YLYN    I++  S
Sbjct: 387 VLRCLFISHWQEEGVYWSLHYLYNRLRDISEETS 420


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 320,784
Number of Sequences: 2352
Number of extensions: 6226
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 563,979
effective HSP length: 56
effective length of database: 432,267
effective search space used: 21181083
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)