BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30082X (571 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 164 6e-43 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 24 1.2 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 164 bits (398), Expect = 6e-43 Identities = 77/83 (92%), Positives = 80/83 (96%) Frame = -1 Query: 571 ETVYISIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEIXALAPSTIKIKIIAPPER 392 ET Y SIMKCDVDIRKDLYANTV+SGGTTMYPGIADRMQKEI ALAPST+KIKIIAPPE+ Sbjct: 51 ETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPEK 110 Query: 391 KYSVWIGGSILASLSTFQQMWIS 323 KYSVWIGGSILASLSTFQQMWIS Sbjct: 111 KYSVWIGGSILASLSTFQQMWIS 133 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 23.8 bits (49), Expect = 1.2 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = +2 Query: 149 DGVRLDVQFSGITRYNVLTVAFRTRTSTTPHSTGVT--RPRCLEALAVDDAGAGLVVFL 319 D +LD F T+ N + ++ R++ STT G T + + AL +D FL Sbjct: 354 DSAKLDKIFDIATKENAMLLSGRSQKSTTGPPPGPTPAQKARMRALNIDRVSRVFFPFL 412 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,673 Number of Sequences: 438 Number of extensions: 2386 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16381902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -