BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30082X (571 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to S... 188 2e-48 At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493 A... 188 2e-48 At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496... 188 2e-48 At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671 A... 188 2e-48 At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292 A... 187 4e-48 At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293 A... 187 4e-48 At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494 A... 183 9e-47 At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497... 183 9e-47 At2g42100.1 68415.m05205 actin, putative very strong similarity ... 174 4e-44 At2g42170.1 68415.m05219 actin, putative similar to actin 2 [Ara... 162 2e-40 At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292 A... 143 6e-35 At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Ac... 142 2e-34 At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary id... 109 1e-24 At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identica... 79 2e-15 At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly i... 71 5e-13 At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly i... 71 5e-13 At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identica... 59 2e-09 At5g56180.1 68418.m07008 actin-related protein, putative (ARP8) ... 48 4e-06 At3g12380.1 68416.m01543 actin/actin-like family protein similar... 42 2e-04 At5g43500.2 68418.m05318 expressed protein 40 9e-04 At5g43500.1 68418.m05319 expressed protein 40 9e-04 At3g14720.1 68416.m01861 mitogen-activated protein kinase, putat... 31 0.54 At3g24210.1 68416.m03038 ankyrin repeat family protein contains ... 27 8.8 At3g20270.2 68416.m02568 lipid-binding serum glycoprotein family... 27 8.8 At3g20270.1 68416.m02567 lipid-binding serum glycoprotein family... 27 8.8 >At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to SP|P53492 Actin 7 (Actin-2) {Arabidopsis thaliana} Length = 377 Score = 188 bits (458), Expect = 2e-48 Identities = 85/100 (85%), Positives = 92/100 (92%) Frame = -1 Query: 571 ETVYISIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEIXALAPSTIKIKIIAPPER 392 ET Y SIMKCDVDIRKDLY N V+SGG+TM+PGIADRM KEI ALAPS++KIK++APPER Sbjct: 278 ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPER 337 Query: 391 KYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 272 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKSEYDESGPSIVHRKCF 377 >At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493 Actin 3 {Arabidopsis thaliana}; supported by full-length cDNA: Ceres: 19581. Length = 377 Score = 188 bits (458), Expect = 2e-48 Identities = 85/100 (85%), Positives = 92/100 (92%) Frame = -1 Query: 571 ETVYISIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEIXALAPSTIKIKIIAPPER 392 ET Y SIMKCDVDIRKDLY N V+SGGTTM+PGIADRM KEI ALAPS++KIK++APPER Sbjct: 278 ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPER 337 Query: 391 KYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 272 KYSVWIGGSILASLSTFQQMWI+K EYDESGP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377 >At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496 Actin 11 {Arabidopsis thaliana} Length = 377 Score = 188 bits (458), Expect = 2e-48 Identities = 85/100 (85%), Positives = 92/100 (92%) Frame = -1 Query: 571 ETVYISIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEIXALAPSTIKIKIIAPPER 392 ET Y SIMKCDVDIRKDLY N V+SGGTTM+PGIADRM KEI ALAPS++KIK++APPER Sbjct: 278 ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPER 337 Query: 391 KYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 272 KYSVWIGGSILASLSTFQQMWI+K EYDESGP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377 >At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671 Actin 1 (Actin 3) {Arabidopsis thaliana} Length = 377 Score = 188 bits (458), Expect = 2e-48 Identities = 85/100 (85%), Positives = 92/100 (92%) Frame = -1 Query: 571 ETVYISIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEIXALAPSTIKIKIIAPPER 392 ET Y SIMKCDVDIRKDLY N V+SGGTTM+PGIADRM KEI ALAPS++KIK++APPER Sbjct: 278 ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPER 337 Query: 391 KYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 272 KYSVWIGGSILASLSTFQQMWI+K EYDESGP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377 >At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292 Actin 2 {Arabidopsis thaliana}; nearly identical to SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and to At1g49240 Length = 377 Score = 187 bits (456), Expect = 4e-48 Identities = 85/100 (85%), Positives = 92/100 (92%) Frame = -1 Query: 571 ETVYISIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEIXALAPSTIKIKIIAPPER 392 ET Y SIMKCDVDIRKDLY N V+SGGTTM+ GIADRM KEI ALAPS++KIK++APPER Sbjct: 278 ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFSGIADRMSKEITALAPSSMKIKVVAPPER 337 Query: 391 KYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 272 KYSVWIGGSILASLSTFQQMWISK EYDE+GPGIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKAEYDEAGPGIVHRKCF 377 >At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293 Actin 8 {Arabidopsis thaliana}; nearly identical to SP|Q96292 Actin 2 [Arabidopsis thaliana] GI:1669387, and to At3g18780 Length = 377 Score = 187 bits (456), Expect = 4e-48 Identities = 85/100 (85%), Positives = 92/100 (92%) Frame = -1 Query: 571 ETVYISIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEIXALAPSTIKIKIIAPPER 392 ET Y SIMKCDVDIRKDLY N V+SGGTTM+ GIADRM KEI ALAPS++KIK++APPER Sbjct: 278 ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFSGIADRMSKEITALAPSSMKIKVVAPPER 337 Query: 391 KYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 272 KYSVWIGGSILASLSTFQQMWISK EYDE+GPGIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKAEYDEAGPGIVHRKCF 377 >At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494 Actin 4 {Arabidopsis thaliana} Length = 377 Score = 183 bits (445), Expect = 9e-47 Identities = 83/100 (83%), Positives = 90/100 (90%) Frame = -1 Query: 571 ETVYISIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEIXALAPSTIKIKIIAPPER 392 ET Y SIMKCDVDIRKDLY N V+SGGTTM+ GI DRM KEI ALAPS++KIK++APPER Sbjct: 278 ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPPER 337 Query: 391 KYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 272 KYSVWIGGSILASLSTFQQMWI+K EYDESGP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377 >At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497 Actin 12 {Arabidopsis thaliana} Length = 377 Score = 183 bits (445), Expect = 9e-47 Identities = 83/100 (83%), Positives = 90/100 (90%) Frame = -1 Query: 571 ETVYISIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEIXALAPSTIKIKIIAPPER 392 ET Y SIMKCDVDIRKDLY N V+SGGTTM+ GI DRM KEI ALAPS++KIK++APPER Sbjct: 278 ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPPER 337 Query: 391 KYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 272 KYSVWIGGSILASLSTFQQMWI+K EYDESGP IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377 >At2g42100.1 68415.m05205 actin, putative very strong similarity to SP|P53496 Actin 11 {Arabidopsis thaliana}, SP|P53493 Actin 3 {Arabidopsis thaliana}; contains Pfam profile PF00022: Actin Length = 378 Score = 174 bits (423), Expect = 4e-44 Identities = 78/100 (78%), Positives = 87/100 (87%) Frame = -1 Query: 571 ETVYISIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEIXALAPSTIKIKIIAPPER 392 ET Y SIMKCDVDIRKDLY N V+SGGTTM+PGIADRM KEI ALAP ++KIK++APPER Sbjct: 279 ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMNKEINALAPPSMKIKVVAPPER 338 Query: 391 KYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 272 KYSVW+GGSILASLS+F MWI+K EYDE G IVHRKCF Sbjct: 339 KYSVWVGGSILASLSSFAPMWITKAEYDEQGGAIVHRKCF 378 >At2g42170.1 68415.m05219 actin, putative similar to actin 2 [Arabidopsis thaliana] gi|9293903|dbj|BAB01806 Length = 329 Score = 162 bits (393), Expect = 2e-40 Identities = 73/100 (73%), Positives = 85/100 (85%) Frame = -1 Query: 571 ETVYISIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEIXALAPSTIKIKIIAPPER 392 E Y SIMKCD DIRKDLY N V+SGGTTM+ GI +RM KEI ALA + ++IKI+APPER Sbjct: 230 EKTYNSIMKCDDDIRKDLYGNIVLSGGTTMFRGIEERMTKEINALAAANMRIKIVAPPER 289 Query: 391 KYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 272 KYSVWIGGSILASLST++QMWI+K EY+E+GP IVH KCF Sbjct: 290 KYSVWIGGSILASLSTYEQMWITKAEYEENGPAIVHTKCF 329 >At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292 Actin 2 {Arabidopsis thaliana}; nearly identical to SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and to At1g49240 Length = 371 Score = 143 bits (347), Expect = 6e-35 Identities = 67/84 (79%), Positives = 75/84 (89%) Frame = -1 Query: 571 ETVYISIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEIXALAPSTIKIKIIAPPER 392 ET Y SIMKCDVDIRKDLY N V+SGGTTM+ GIADRM KEI ALAPS++KIK++APPER Sbjct: 278 ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFSGIADRMSKEITALAPSSMKIKVVAPPER 337 Query: 391 KYSVWIGGSILASLSTFQQMWISK 320 KYSVWIGGSILASLSTFQQ+ I + Sbjct: 338 KYSVWIGGSILASLSTFQQVKIDQ 361 >At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Actin 11 {Arabidopsis thaliana}; contains Pfam profile PF00022: Actin Length = 366 Score = 142 bits (343), Expect = 2e-34 Identities = 61/94 (64%), Positives = 77/94 (81%) Frame = -1 Query: 556 SIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEIXALAPSTIKIKIIAPPERKYSVW 377 SI+KC VD R+D+Y N +M+GGTTM GI +RM KE+ AL PS++K+K++ PPE + SVW Sbjct: 272 SILKCPVDTRRDMYGNILMTGGTTMLHGIKERMTKELNALVPSSMKVKVVVPPESECSVW 331 Query: 376 IGGSILASLSTFQQMWISKEEYDESGPGIVHRKC 275 IGGSILASLSTF QMWI+K+EY+E G IVHRKC Sbjct: 332 IGGSILASLSTFHQMWITKDEYEEHGAAIVHRKC 365 >At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary identical to actin-related protein 4 (ARP4) [Arabidopsis thaliana] GI:21427463; contains Pfam profile PF00022: Actin; supporting cDNA gi|21427462|gb|AF507912.1| Length = 441 Score = 109 bits (263), Expect = 1e-24 Identities = 47/97 (48%), Positives = 72/97 (74%), Gaps = 3/97 (3%) Frame = -1 Query: 556 SIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEIXALAPSTIKIKIIAP---PERKY 386 SI KCDVDIR++LY++ +++GGT+ + +R++K++ +P + ++K++A ER++ Sbjct: 344 SINKCDVDIRRELYSSILLAGGTSSMQQLKERLEKDLIEESPHSARVKVLASGNTTERRF 403 Query: 385 SVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKC 275 SVWIGGSILASL +FQQMW SK EY+E G + RKC Sbjct: 404 SVWIGGSILASLGSFQQMWFSKSEYEEHGASYIQRKC 440 >At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identical to actin-related protein 7 (ARP7) [Arabidopsis thaliana] GI:21427469; contains Pfam profile PF00022: Actin Length = 363 Score = 79.4 bits (187), Expect = 2e-15 Identities = 40/91 (43%), Positives = 53/91 (58%), Gaps = 6/91 (6%) Frame = -1 Query: 526 KDLYANTVMSGGTTMYPGIADRMQKEIXALAPSTIKIKIIAPPERK------YSVWIGGS 365 + L NTV+ GGTT G R QKE L S I+ ++ PPE YS W+GG+ Sbjct: 274 RQLLENTVLCGGTTSMTGFESRFQKEAN-LCSSAIRPTLVKPPEYMPENLGMYSAWVGGA 332 Query: 364 ILASLSTFQQMWISKEEYDESGPGIVHRKCF 272 ILA + Q ++K +YDE+GP +VHRKCF Sbjct: 333 ILAKVVFPQNQHVTKADYDETGPSVVHRKCF 363 >At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly identical to actin-related protein 6 (ARP6) [Arabidopsis thaliana] GI:21427467; contains Pfam profile PF00022: Actin Length = 421 Score = 70.9 bits (166), Expect = 5e-13 Identities = 32/100 (32%), Positives = 56/100 (56%) Frame = -1 Query: 571 ETVYISIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEIXALAPSTIKIKIIAPPER 392 E + +I C ++ LY + +++GG+T++P + +R++ E+ L P +KI + Sbjct: 321 ECIVRAINSCHSYLQPVLYQSIILTGGSTLFPQLKERLEGELRPLVPDHFDVKITTQEDP 380 Query: 391 KYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 272 VW GGS+LAS F+ M ++K EY+E G R+ F Sbjct: 381 ILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFF 420 >At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly identical to actin-related protein 2 (ARP2) [Arabidopsis thaliana] GI:3818624; contains Pfam profile PF00022: Actin Length = 389 Score = 70.9 bits (166), Expect = 5e-13 Identities = 37/103 (35%), Positives = 61/103 (59%), Gaps = 12/103 (11%) Frame = -1 Query: 571 ETVYISIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEIXALAPSTI---------- 422 + V+ I + D+D R LY + V+SGG+TMYPG+ R++KEI T+ Sbjct: 277 DMVFRCIQEMDIDNRMMLYQHIVLSGGSTMYPGLPSRLEKEIQDRYLDTVLKGNKDGLKK 336 Query: 421 -KIKIIAPPERKYSVWIGGSILAS-LSTFQQMWISKEEYDESG 299 +++I PP RK+ V++GG++LA + + WI++E+Y E G Sbjct: 337 LRLRIEDPPRRKHMVYLGGAVLAGIMKDAPEFWINREDYMEEG 379 >At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identical to actin-related protein 3 (ARP3) [Arabidopsis thaliana] GI:21427461; contains Pfam profile PF00022: Actin Length = 427 Score = 58.8 bits (136), Expect = 2e-09 Identities = 30/104 (28%), Positives = 55/104 (52%), Gaps = 16/104 (15%) Frame = -1 Query: 553 IMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEIXALAPSTI---------------- 422 I +D R+ LY N V+SGG+TM+ R+Q+++ + + + Sbjct: 313 IQSAPIDTRRALYKNIVLSGGSTMFKDFGRRLQRDLKKIVDARVLANNARTGGEITSQPV 372 Query: 421 KIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGI 290 ++ +++ P ++++VW GGS+L+S F +KEEY+E G I Sbjct: 373 EVNVVSHPVQRFAVWFGGSVLSSTPEFFASCRTKEEYEEYGASI 416 >At5g56180.1 68418.m07008 actin-related protein, putative (ARP8) strong similarity to actin-related protein 8A (ARP8) [Arabidopsis thaliana] GI:21427473; contains Pfam profile PF00022: Actin; supporting cDNA gi|21427470|gb|AF507916.1| Length = 471 Score = 48.0 bits (109), Expect = 4e-06 Identities = 21/72 (29%), Positives = 45/72 (62%), Gaps = 3/72 (4%) Frame = -1 Query: 517 YANTVMSGGTTMYPGIADRMQKEIXALAPSTIK--IKIIAPPERKYSVWIGGSILASLST 344 + V++GG+ PG+++R+++E+ PS+I I++I PP + W G ++++LS Sbjct: 392 FKTVVLTGGSACLPGLSERLERELQDHLPSSISNGIRVIPPPYGVDTSWHGAKLISNLSI 451 Query: 343 FQQMW-ISKEEY 311 F W I+++++ Sbjct: 452 FPGPWCITRKQF 463 >At3g12380.1 68416.m01543 actin/actin-like family protein similar to SP|P53946 Actin-like protein ARP5 {Saccharomyces cerevisiae}; contains Pfam profile PF00022: Actin Length = 724 Score = 42.3 bits (95), Expect = 2e-04 Identities = 20/79 (25%), Positives = 40/79 (50%) Frame = -1 Query: 535 DIRKDLYANTVMSGGTTMYPGIADRMQKEIXALAPSTIKIKIIAPPERKYSVWIGGSILA 356 ++ + L ++ +M+GG ++ PG+ +R++ I + P I ++ + W G S A Sbjct: 632 ELEERLTSSILMTGGCSLLPGMNERLECGIRMIRPCGSPINVVRAMDPVLDAWRGASAFA 691 Query: 355 SLSTFQQMWISKEEYDESG 299 + F +K +YDE G Sbjct: 692 ANLNFLGNAFTKMDYDEKG 710 >At5g43500.2 68418.m05318 expressed protein Length = 584 Score = 40.3 bits (90), Expect = 9e-04 Identities = 22/96 (22%), Positives = 48/96 (50%), Gaps = 5/96 (5%) Frame = -1 Query: 571 ETVYISIMKCD-VDIRKDLYANTVMSGGTTMYPGIADRMQKEIXALAPSTIKIKII---- 407 E + SI+ +D+R+ L+++ + GG + G+ +++ + P T I + Sbjct: 464 EAITSSILSAGRIDLRRKLFSSIQLIGGAGLTKGLVAAVEERVLHAIPPTEAIDTVQVLP 523 Query: 406 APPERKYSVWIGGSILASLSTFQQMWISKEEYDESG 299 + E ++ W GG+IL L ++ WI + ++ +G Sbjct: 524 SRTEPQFVTWKGGAILGILDFGREAWIERHQWMVNG 559 >At5g43500.1 68418.m05319 expressed protein Length = 596 Score = 40.3 bits (90), Expect = 9e-04 Identities = 22/96 (22%), Positives = 48/96 (50%), Gaps = 5/96 (5%) Frame = -1 Query: 571 ETVYISIMKCD-VDIRKDLYANTVMSGGTTMYPGIADRMQKEIXALAPSTIKIKII---- 407 E + SI+ +D+R+ L+++ + GG + G+ +++ + P T I + Sbjct: 476 EAITSSILSAGRIDLRRKLFSSIQLIGGAGLTKGLVAAVEERVLHAIPPTEAIDTVQVLP 535 Query: 406 APPERKYSVWIGGSILASLSTFQQMWISKEEYDESG 299 + E ++ W GG+IL L ++ WI + ++ +G Sbjct: 536 SRTEPQFVTWKGGAILGILDFGREAWIERHQWMVNG 571 >At3g14720.1 68416.m01861 mitogen-activated protein kinase, putative / MAPK, putative (MPK19) identical to mitogen-activated protein kinase (MAPK)(AtMPK19), PMID:12119167; Length = 586 Score = 31.1 bits (67), Expect = 0.54 Identities = 17/63 (26%), Positives = 33/63 (52%) Frame = -1 Query: 571 ETVYISIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEIXALAPSTIKIKIIAPPER 392 E +Y I++ + KD Y N+ G + +YP ++K+ L ++ K + PP+R Sbjct: 338 ELIYREILEYHPQLLKD-YMNS--EGSSFLYPSAIGHLRKQFAYLEENSGKSGPVIPPDR 394 Query: 391 KYS 383 K++ Sbjct: 395 KHA 397 >At3g24210.1 68416.m03038 ankyrin repeat family protein contains ankyrin repeats, Pfam domain PF00023 Length = 607 Score = 27.1 bits (57), Expect = 8.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -3 Query: 461 DAEGDXRPRALDHQDQDHRSPREEVLRMDRWIHPGFPV 348 D E +P+AL H S ++ LR W+ P FP+ Sbjct: 423 DNEHYRKPKALVSDKTRHESEYKKGLRPVLWLSPNFPL 460 >At3g20270.2 68416.m02568 lipid-binding serum glycoprotein family protein similar to SP|P17213 Bactericidal permeability-increasing protein precursor (BPI) {Homo sapiens}; contains Pfam profile PF02886: LBP / BPI / CETP family, C-terminal domain Length = 515 Score = 27.1 bits (57), Expect = 8.8 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 505 VMSGGTTMYPGIADRMQKEIXALAPSTIKIKII 407 + G + +Y G+ D QK I + T+ KI+ Sbjct: 209 INGGASWLYQGVVDAFQKMIISTVEKTVSTKIV 241 >At3g20270.1 68416.m02567 lipid-binding serum glycoprotein family protein similar to SP|P17213 Bactericidal permeability-increasing protein precursor (BPI) {Homo sapiens}; contains Pfam profile PF02886: LBP / BPI / CETP family, C-terminal domain Length = 722 Score = 27.1 bits (57), Expect = 8.8 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 505 VMSGGTTMYPGIADRMQKEIXALAPSTIKIKII 407 + G + +Y G+ D QK I + T+ KI+ Sbjct: 416 INGGASWLYQGVVDAFQKMIISTVEKTVSTKIV 448 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,927,165 Number of Sequences: 28952 Number of extensions: 184533 Number of successful extensions: 548 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 541 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1102220672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -